DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31975

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:135/304 - (44%) Gaps:34/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENVASWKVFYKERN------TYGQYIP 140
            |:||.::||..:..|:.::|.......:||:.|     .:...|:.|..|:.      .|....|
  Fly    37 GDNYGSVLLAIHARLQKSNGESFEEQLVAKVPP-----IDPKYWQFFQPEQTCLTENAVYKILAP 96

  Fly   141 EFEQMYKDAG----KKISFGPRYYESQIELD--------DELIVLEDLGKRGFRNVDRQNGLDIQ 193
            ....:..:||    .:....||:|..:..|:        :.::|||:|...|:.:..|....|:.
  Fly    97 ALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLA 161

  Fly   194 HTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLK-ELRENQLKAYIDAFPLYDASHL 257
            ||...|:.:|:|||.|   ..|:...||.:.:.:........ .....:.|:.:.|..|.|....
  Fly   162 HTLLALKYMAEFHALS---LALRILRPEVFREQVRPFFKKFDWHAEAPEWKSVMKAETLEDIRRA 223

  Fly   258 TND---VQAYGSQADDMFQSF---AP-KIEGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQ 315
            ||:   :.|...:..|.|..|   || :.:|.|..:.|.|.|.||||::|...|...|:..:|.|
  Fly   224 TNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQ 288

  Fly   316 MSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLK 359
            .:::.|...|::..:|||.:..|...:|:::::.|:|.....|:
  Fly   289 TAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAFERCLR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 75/304 (25%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 75/304 (25%)
APH <214..329 CDD:279908 34/114 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459608
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.