DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31436

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:425 Identity:92/425 - (21%)
Similarity:171/425 - (40%) Gaps:97/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QRQQVNDMVRETEDIAIEPIPAWLDQQKFEPILE-RDFPDLKKIKSFRLEPTAGKGENYTTLLLR 91
            |..|.||      |..:.  |.||:.:....:|| .:.....|:......|.:.||::|.:::.|
  Fly     6 QNNQFND------DELVP--PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFR 62

  Fly    92 ANFELELNDGSEQSISYMAKILPNS-GNRENVASWK-VFYKERNTYGQYIPEFEQMYKDAGKKIS 154
            |..:.....|..|. |.:.|.:|.: |:::::.... :|..|...|.:.:||||::.:..|....
  Fly    63 ARVKYTNRKGEFQK-SLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQ 126

  Fly   155 FGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLE-------KLAQFHAASAVR 212
            .........:| ..::::.|||.:.|:        :.::..:|||:       |||::||.|   
  Fly   127 LYVNCIYHSLE-PHQVLIFEDLAEMGY--------IVLRDRDATLDEIRRIYFKLAKWHAVS--- 179

  Fly   213 FELKGSYPEEYNQNLCSVVDSLKELRENQLKAYIDAFP--LYDASHLTND----------VQAYG 265
            .:::...||                       :::::.  |::..|:.||          |:..|
  Fly   180 LKVQNEQPE-----------------------FLESYTHGLFEMPHVLNDPFMRTGMEFFVELLG 221

  Fly   266 SQADDMFQSFAPKIEG-----------------------EFRVLNHGDAWCNNIMYQYDEAGKLA 307
            .:.:  ...:.|..|.                       |:.||.|||....|||:::.:...|.
  Fly   222 KEPE--LNKYKPYFESIKDDFLERLVEEWKDIRKSQKKDEYWVLCHGDLHLRNIMFKHKDTVSLE 284

  Fly   308 EVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRS 372
            :...:|.|:|.......||||.|....|.:.:...:|.||.:|...|.:.||.:.|...:||...
  Fly   285 DCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSG 349

  Fly   373 LHQSIFIYGDWILPIVSILLPLV------LIDGGD 401
            |.:.:..:..:...::|..|||:      .:|.||
  Fly   350 LWKRLHQHKYYEFFLISTFLPLMWALRDKSVDFGD 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 69/325 (21%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 69/325 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.