DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31288

DIOPT Version :10

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:44 Identity:12/44 - (27%)
Similarity:20/44 - (45%) Gaps:2/44 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLRQQREKKRREE-WDRLESIRLAEEEAELARRRALEK-ERIDR 72
            |:||......|.| |..::.....:...:.:..|.::| .||||
  Fly    76 LVRQYNLLLHRSELWSIVDEFAALKHSLQSSEIRIVQKYNRIDR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKL 81..363 CDD:397213
CG31288NP_733094.1 EcKL 50..331 CDD:397213 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.