DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG32195

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:419 Identity:106/419 - (25%)
Similarity:189/419 - (45%) Gaps:58/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FEPILERDFP-DLKKIKSFRLEPTAGKGENYTTLLLRANFELELN-DGSEQSISYMAK-ILPNSG 117
            ||..|.|.:. ::.::::|.::..:.||||:.:::.|.......: ||:.:|..|:.| :||   
  Fly    11 FERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYILKDLLP--- 72

  Fly   118 NRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIELD---------DELIVL 173
                 |:..:...|::.:...:|..:.:.::|.|:|.      |.::..|         .||.:|
  Fly    73 -----AAAALGTNEKDMFEVLLPAMQAILEEAPKEIG------EHKLSADCLLVEISAGKELYIL 126

  Fly   174 EDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELK---------GSYPEEYNQNLCS 229
            ||||..|:.:.||:.||:::..:..:.||||||.||.|.:|.|         ..|....|.....
  Fly   127 EDLGALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLNDRFAQ 191

  Fly   230 VVDSLKELRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEFRVLNHGDAWCN 294
            .:  :.|..|...:|:.:..|...........:||..:..|:..   |. :.....:.|||.|.|
  Fly   192 AL--VLEGAEYAAEAFAEELPEISKKMKAQIPKAYTKRMRDVVD---PN-KSSLNAVIHGDPWLN 250

  Fly   295 NIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLK 359
            |||  :|...|.|  ..||.|...:.|||.||.:|..:|.:.::.:...|.|:.:|.:.|:|:|:
  Fly   251 NIM--FDFVNKKA--TLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLNYYFDNLLETLR 311

  Fly   360 LLKYPKPLPSLRSLHQSI---FIYGDWILPIVSILLPLVLIDGGDDANMD----SLMDGEGAGDK 417
            ...|...||:...|...:   ..||.:     :::..|.:.....:|::|    :.:|.: |..|
  Fly   312 HCGYKDTLPTFGQLKDEMKRCLFYGYY-----TVVCELPICCASPEASVDFGVHTFVDTD-AMLK 370

  Fly   418 IRNNMFKNHRVIKHQKEILPWAHRRGAFE 446
            .|:.:|.:.||.:..|..|....|.|..|
  Fly   371 KRHQLFASERVRQTIKATLLMFDREGILE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 80/301 (27%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 80/301 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.