DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and T16G1.6

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:338 Identity:72/338 - (21%)
Similarity:132/338 - (39%) Gaps:104/338 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SEQSISYMAKILPNSGNRENVASWKVFYKERNTYGQYIPEFE-QMYKDAGK----------KISF 155
            |.|||         :.|.|.:  |.:|..|    .|::...| ..|..|.|          ||.|
 Worm    96 SNQSI---------NENEEEL--WAMFENE----AQHLHNREVNFYVLAEKWNKPEELLNAKIFF 145

  Fly   156 GPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQH---------TEATLEKLAQFHAAS-- 209
            ..: ::|:.:|            :||..::..:.:.|:|         ....|:.:||..|.|  
 Worm   146 SKK-FDSENKL------------KGFLGMEYVDDVTIRHLYCNLKPYELHPVLKAVAQLQAESLH 197

  Fly   210 ------------------AVRFE---LKGSYPEEYNQNLCSVVDSLKELRENQLKAYIDAFPLYD 253
                              ...|.   |||:|.:            .:::...:||          
 Worm   198 LSDEELQSISGFDFKQMMGTMFNDDGLKGNYKQ------------TRDINPERLK---------- 240

  Fly   254 ASHLTNDVQAYGSQADDM-FQSFAPKIEGEFR-VLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQM 316
              ..|:.|:|:|.:..:. |.....|:.|..: ||.|||.|..||::..:: ||.:....:|.|:
 Worm   241 --EKTDIVEAFGMEVVNFEFAGNLNKVVGIHKDVLVHGDLWAANILWNEND-GKFSASKVIDYQI 302

  Fly   317 SRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYG 381
            ....:||:||:.:.|.:.....:.|.::.|::.::|..:|:|:..:.|..|..|:..::..|:.|
 Worm   303 IHMGNPAEDLVRVFLCTLSGADRQAHWEKLLEQFYEYFLEALEDNEIPYTLDQLKESYRLYFVTG 367

  Fly   382 DWILPIVSILLPL 394
            .      .::|||
 Worm   368 S------LVMLPL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 64/305 (21%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 72/338 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.