DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and H06H21.8

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:405 Identity:90/405 - (22%)
Similarity:153/405 - (37%) Gaps:120/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AKLSKQQRQQVNDMVRETEDIAIEPIPAWLDQQKFEPILERDFPDLKKIKSFRLE------PTAG 80
            ||| ||.|:.|.....|.|:              |...::..|..|:..|||..|      ...|
 Worm     3 AKL-KQLRRLVESSFPEIEN--------------FHEKVDASFEKLENAKSFWSEIYVAHLKVVG 52

  Fly    81 KG----ENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENVASWKVFYKERNTYGQYIPE 141
            .|    |:....:.|.: |..|....|.:::::..:|.....:||     :|||... ||. ||.
 Worm    53 DGVKVPESVFIKVPRIS-ENVLRCEDESAVNHLNDVLLYYSKKEN-----LFYKHFE-YGS-IPN 109

  Fly   142 FEQMYKDAGKKISFGPRYYESQIELDDEL---IVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLA 203
            |.            .|:.|.:: :::.|.   ||.|:|.::.|. |:...||..:.....:|.||
 Worm   110 FP------------FPKVYFTE-DINGEATGGIVAENLSEKVFA-VEHIPGLKHEQILRLMEALA 160

  Fly   204 QFHAASAVRFELKGSYPEEYNQNLCSVVDSLKELRENQLKAYIDAFPLYDASHLTNDVQAYGSQA 268
            ..|:     |.:|                     |::  |:|:::|  .:.:| ..:..:.|.| 
 Worm   161 GLHS-----FLMK---------------------RDD--KSYVESF--VEGAH-GRETFSEGMQ- 193

  Fly   269 DDMF------QSFAPKIEGEFRVLN--------------------------HGDAWCNNIMYQYD 301
            :.||      ::.:|::.|..|:.|                          |.|....|::::.|
 Worm   194 NMMFEEALTLENVSPEVFGNDRIRNIKWSFDYSIKNKATADAISAFPGIICHADLNVTNVLWKKD 258

  Fly   302 EAGKLAEVN-FVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPK 365
            .|..  |:: .:|.||....|.|.|::.::......:|:.......:..||:.|.| |...|.|.
 Worm   259 SAKD--EISAIIDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQNYLDHYHKTLTE-LSNGKAPF 320

  Fly   366 PLPSLRSLHQSIFIY 380
            .:..|  |||...||
 Worm   321 SMEEL--LHQYSLIY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 65/321 (20%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 43/217 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.