DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and E02C12.6

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_505426.2 Gene:E02C12.6 / 183987 WormBaseID:WBGene00017092 Length:419 Species:Caenorhabditis elegans


Alignment Length:424 Identity:80/424 - (18%)
Similarity:141/424 - (33%) Gaps:130/424 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PNSGNRENVASWKVFYKE-------RNTYGQ-------------------YIPEFEQMYKDAGKK 152
            |.:|..|...:|:...|:       :.|:|:                   ..|:::.:  :.|||
 Worm     6 PANGILETHVTWEDVEKDLQNSLGTKATFGENKTASNISDLKGFMSRIACVEPDWQNV--EDGKK 68

  Fly   153 ISFGPRYYESQIELDDELIVLEDL----GKRGF---------------RNVD--------RQNGL 190
            :   |..:..:|.....|:.|..:    |..||               .|::        :.|..
 Worm    69 L---PVRFALKISSQLALVALSKMLNFGGGNGFTEEKLKKFSKLTRKSHNIEVETYKVLTKFNHP 130

  Fly   191 DIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLKELRENQLKAYIDAFPLYD-- 253
            ||.:|:  :..|..|:...    :|||....::..|: .|:::.|.:..:.:.|.|.....:.  
 Worm   131 DIPYTK--VYSLKPFNGED----DLKGYLITDFIPNV-HVIEAYKSIPADNIAATIRGIATFSAL 188

  Fly   254 ASHLTNDVQAYGSQADDM----------------FQSFAPKIEGEFR------------------ 284
            |.||..:.|......|.:                |::...|.||:..                  
 Worm   189 AEHLEREEQKSFMSTDFLELLFEDFFTDAELSKKFEALKTKFEGQQHAEKVSKLIKVFAHYKALV 253

  Fly   285 --------------VLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTE 335
                          |..|||.|.:|||:..|.:.||.....:|.|......|..||..::|....
 Worm   254 KKYTNISDLLGLKPVFIHGDLWQSNIMFTLDNSKKLKLEAIIDWQSVSRIPPGIDLSRIMLGCLS 318

  Fly   336 LDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDW----ILPIVSILLPLVL 396
            ...:..:...|:|.|||...:     .:.|.|.:.:.|..|..:|...    |||.:|..|....
 Worm   319 AQERRERGTELLKLYHETYAK-----VFGKELFTFQELQDSYNLYAPMMAMLILPSLSSFLDSAQ 378

  Fly   397 ID------GGDDANMDSLMDGEGAGDKIRNNMFK 424
            |.      ..::.|:..:...|...|...:|:.|
 Worm   379 ISKEEKAAAAEEVNLKEVAMIEDILDIHESNLKK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 64/351 (18%)
E02C12.6NP_505426.2 DUF1679 3..410 CDD:369592 78/420 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.