DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and F59B1.8

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:355 Identity:67/355 - (18%)
Similarity:140/355 - (39%) Gaps:76/355 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LRANFELELNDGSEQSISYMAKILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKIS 154
            :.|:||.....|....:.:....    |:.|.:...|||:.::         ||:   |...|..
 Worm   109 VHAHFEKSCQKGHNLEVEFCEAF----GHLEGLLLPKVFFSQK---------FEE---DNPNKGF 157

  Fly   155 FGPRYYE--------SQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAV 211
            .|..:.|        ..:.:|:...:|:.|.:....::..::..::.:.||..|.|....:... 
 Worm   158 VGMEFVEGSVVRHCYENVTVDELQPILKALARLQALSLSTESCRNLDNGEAFEESLMDMLSEDG- 221

  Fly   212 RFELKGSYPEEYN--QNLCSVVDSLKELRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQS 274
               |||.:.:..|  |.|...|:.:::..:..|.       |....:|.                
 Worm   222 ---LKGIFDQSRNIDQKLSEKVERIEQNHKEILN-------LETVLNLN---------------- 260

  Fly   275 FAPKIEG-EFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDI 338
               |:.| :.:|:.|||.|..||::...:.|.:|: ..:|.|.|...:||:||:.|::|:.....
 Worm   261 ---KVVGIDQKVICHGDLWAANILWTQTDGGFIAD-KVLDYQESHMGNPAEDLVRLLVSTISGAD 321

  Fly   339 KIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDA 403
            :.:.::::::.::....:.:.....|..|..|::..:..|..|  .|.::|:..|.|      |.
 Worm   322 RQSHWEHILEQFYTYFTDEIGSNNAPYTLEQLKTSFKLYFPVG--ALTLISLFGPAV------DM 378

  Fly   404 NMDSLMDGEGAGDKIRNNMFKNHRVIKHQK 433
            .:..:..|:.          :|:|.|..:|
 Worm   379 KLQGMESGKA----------ENYRRIVIEK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 52/283 (18%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 67/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.