DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MARS1 and GstD10

DIOPT Version :9

Sequence 1:NP_004981.2 Gene:MARS1 / 4141 HGNCID:6898 Length:900 Species:Homo sapiens
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:165 Identity:46/165 - (27%)
Similarity:68/165 - (41%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRLFVSDGVPGCLPVLAAAGRARG---RAEVLISTVGPEDCVVPFL-TRPK--VPVLQLDSGNYL 59
            |.|:...|...|..||..| :|.|   ..:.:|:|...|.....:| ..|:  :|.|. |.|..|
  Fly     1 MDLYYRPGSAPCRSVLMTA-KALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLH-DHGFAL 63

Human    60 FSTSAICRYFFLLSGWEQDD-----------LTNQWLEWEATELQPALSAALYYLVVQGKK--GE 111
            :.:.||..|  |:..:.:||           |.||.|.::...|..:.| ..||..:..||  .|
  Fly    64 WESRAIMVY--LVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFS-EYYYPQIFLKKPANE 125

Human   112 DVLGSVRRALTHIDHSLSRQNCPFLAGETESLADI 146
            :....:..|...::..|..|.  :.||...|||||
  Fly   126 ENYKKIEVAFEFLNTFLEGQT--YSAGGDYSLADI 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MARS1NP_004981.2 Thioredoxin_like <27..68 CDD:294274 12/43 (28%)
GstA <47..189 CDD:223698 32/115 (28%)
GST_C_MetRS_N 77..179 CDD:198340 23/83 (28%)
PRK12268 264..819 CDD:237029
MetRS_core 265..633 CDD:173907
'HIGH' region 273..283
'KMSKS' region 593..597
Anticodon_Ia_Met 642..771 CDD:153411
MetRS_RNA 845..889 CDD:238475
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 23/77 (30%)
PLN02473 3..196 CDD:166114 45/163 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.