DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MARS1 and GstD5

DIOPT Version :9

Sequence 1:NP_004981.2 Gene:MARS1 / 4141 HGNCID:6898 Length:900 Species:Homo sapiens
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:164 Identity:39/164 - (23%)
Similarity:73/164 - (44%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRLFVSDGVPGCLPVLAAAGRARGRAEV-LISTVGPEDCVVPFL-TRPK--VPVLQLDSGNYLFS 61
            |..:.|....||..|:..|.....:..: |::|:..:.....|: ..|:  :|.| :|:|..::.
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTL-VDNGFSIWE 64

Human    62 TSAICRYFFLLSGWEQDD-----------LTNQWLEWEATELQPALSAALYYLVVQGKKGEDV-L 114
            :.||..|  |:..:.:||           |.||.|.::...|..:.:...|.|...||.|.|. .
  Fly    65 SRAIAVY--LVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDF 127

Human   115 GSVRRALTHIDHSLSRQNCPFLAGETESLADIVL 148
            ..:..:..:::..|..||  ::||:..::|||.:
  Fly   128 KKIESSFEYLNIFLEGQN--YVAGDHLTVADIAI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MARS1NP_004981.2 Thioredoxin_like <27..68 CDD:294274 10/44 (23%)
GstA <47..189 CDD:223698 29/116 (25%)
GST_C_MetRS_N 77..179 CDD:198340 21/84 (25%)
PRK12268 264..819 CDD:237029
MetRS_core 265..633 CDD:173907
'HIGH' region 273..283
'KMSKS' region 593..597
Anticodon_Ia_Met 642..771 CDD:153411
MetRS_RNA 845..889 CDD:238475
GstD5NP_524914.3 GstA 1..184 CDD:223698 39/164 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/75 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.