DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MARS1 and GstD9

DIOPT Version :9

Sequence 1:NP_004981.2 Gene:MARS1 / 4141 HGNCID:6898 Length:900 Species:Homo sapiens
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:191 Identity:47/191 - (24%)
Similarity:68/191 - (35%) Gaps:51/191 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   546 VDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGVGVFGDMAQDT 610
            :|.|..:.  :.|..|::....|||.|.|...|. |.|.|:|..|..|.:....:...    .|.
  Fly     2 LDFYYMLY--SAPCRSILMTARALGLELNKKQVD-LDAGEHLKPEFVKINPQHTIPTL----VDD 59

Human   611 GIPADIW--RFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMF-VSKFFGGYVPEM 672
            |..  ||  |..|:|: .|..|...|   |..|:..:..     .||:...| :|..:..||   
  Fly    60 GFA--IWESRAILIYL-AEKYDKDGS---LYPKDPQQRA-----VINQRLFFDLSTLYQSYV--- 110

Human   673 VLTPDDQRLLAHVTLELQHYHQLLEKV----------RIRDALRSILTISRHGNQYIQVNE 723
                            ..:|.||.|.|          :|.||.....|:.: |.||..:|:
  Fly   111 ----------------YYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLK-GQQYAALNK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MARS1NP_004981.2 Thioredoxin_like <27..68 CDD:294274
GstA <47..189 CDD:223698
GST_C_MetRS_N 77..179 CDD:198340
PRK12268 264..819 CDD:237029 47/191 (25%)
MetRS_core 265..633 CDD:173907 25/88 (28%)
'HIGH' region 273..283
'KMSKS' region 593..597 1/3 (33%)
Anticodon_Ia_Met 642..771 CDD:153411 19/93 (20%)
MetRS_RNA 845..889 CDD:238475
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/82 (28%)
GstA 4..187 CDD:223698 46/189 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.