| Sequence 1: | NP_004981.2 | Gene: | MARS1 / 4141 | HGNCID: | 6898 | Length: | 900 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001246500.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
| Alignment Length: | 207 | Identity: | 41/207 - (19%) |
|---|---|---|---|
| Similarity: | 71/207 - (34%) | Gaps: | 63/207 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Human 48 VPVLQLDSGNYLFSTSAICRYFFLLSGWEQDDLTNQWLEWEA--------------TELQPALSA 98
Human 99 ALYYLVVQGKKGE-----DVLGSVRRALTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQD 158
Human 159 PAYLPE-ELSALHSWFQTLSTQEPCQRAAETVLKQQGVLALRPYLQKQPQPSPAEGRAVTNEPEE 222
Human 223 EELATLSEEEIA 234 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| MARS1 | NP_004981.2 | Thioredoxin_like | <27..68 | CDD:294274 | 6/19 (32%) |
| GstA | <47..189 | CDD:223698 | 30/160 (19%) | ||
| GST_C_MetRS_N | 77..179 | CDD:198340 | 22/121 (18%) | ||
| PRK12268 | 264..819 | CDD:237029 | |||
| MetRS_core | 265..633 | CDD:173907 | |||
| 'HIGH' region | 273..283 | ||||
| 'KMSKS' region | 593..597 | ||||
| Anticodon_Ia_Met | 642..771 | CDD:153411 | |||
| MetRS_RNA | 845..889 | CDD:238475 | |||
| GstE12 | NP_001246500.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 7/22 (32%) |
| GstA | 6..201 | CDD:223698 | 37/188 (20%) | ||
| GST_C_Delta_Epsilon | 92..210 | CDD:198287 | 29/159 (18%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||