DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MARS1 and GstE7

DIOPT Version :9

Sequence 1:NP_004981.2 Gene:MARS1 / 4141 HGNCID:6898 Length:900 Species:Homo sapiens
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:232 Identity:48/232 - (20%)
Similarity:83/232 - (35%) Gaps:78/232 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    28 VLISTVGPEDCVVPFLTR-PK--VPVLQLDSGNYLFSTSAICRYFFLLSGWEQDDLTNQWLEWEA 89
            |.::|...|:....||.: |:  ||.|: |.|:|::.:.||..|  |:|.:.:.|          
  Fly    32 VEVNTRAKENFSEEFLKKNPQHTVPTLE-DDGHYIWDSHAIIAY--LVSKYGKTD---------- 83

Human    90 TELQPALSAALYYLVVQGKKGEDVLGSVRRALTHIDHSLSRQNCPFLAGETESLADIVLWGALYP 154
                     :||        .:|:|   :||:  :|..|..::....|....|:...:..|.   
  Fly    84 ---------SLY--------PKDLL---QRAV--VDQRLHFESGVIFANALRSITKPLFAGK--- 123

Human   155 LLQDPAYLPEELSALHSWFQTLSTQEPCQRAAETVLKQQGVLALRPYLQKQPQPSPAEGRAVTNE 219
                               ||:..:|......|.....:..||...|:         .|..:| .
  Fly   124 -------------------QTMIPKERYDAIIEVYDFLEKFLAGNDYV---------AGNQLT-I 159

Human   220 PEEEELATLSEEEIAMAV--------TAWEKGLESLP 248
            .:...::|:|..|:.:.|        .||.|.|:.||
  Fly   160 ADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKLP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MARS1NP_004981.2 Thioredoxin_like <27..68 CDD:294274 14/42 (33%)
GstA <47..189 CDD:223698 27/143 (19%)
GST_C_MetRS_N 77..179 CDD:198340 14/101 (14%)
PRK12268 264..819 CDD:237029
MetRS_core 265..633 CDD:173907
'HIGH' region 273..283
'KMSKS' region 593..597
Anticodon_Ia_Met 642..771 CDD:153411
MetRS_RNA 845..889 CDD:238475
GstE7NP_611329.1 GstA 4..196 CDD:223698 46/230 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 16/47 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/143 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.