DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CHKov2

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:434 Identity:148/434 - (34%)
Similarity:229/434 - (52%) Gaps:58/434 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PEWLNQTQFEELLAAHVDQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLKV 126
            |:|:.:..|..||......|..|:.|....|::.||||.|::|||.|:::|.|.|.:.|.::||:
  Fly     7 PQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKI 71

  Fly   127 PHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDIT--FAPKAFKLDSVKEPKLANTV 189
            | .||:.|:. .....|::|..:|..::|:||:|| ||...|:  |.|...|...  ||..::.:
  Fly    72 P-LVPEDEKN-DFHEMFDAELDMYDHLIPELEDLY-AKNTSISPKFKPVHLKFPG--EPVKSDYI 131

  Fly   190 LMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYE---------------- 238
            |:.||.:.|::|.:|.:.|...:.:..||||||:||||:..|...|.||                
  Fly   132 LLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFTTEHQKLL 196

  Fly   239 DQFVNGVMGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMT-- 301
            |:|       |....|.|.|.|                  :::  .||...:.:..|:...:|  
  Fly   197 DEF-------NINFCMPFLECM------------------QQY--NLEPGQLVLISDYTSQLTDL 234

  Fly   302 ------ADPDEFNVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHI 360
                  .||.|.:||||||.|.||.:||..:..||:|:.|||||.||||:|.|||..:::||...
  Fly   235 NIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKF 299

  Fly   361 DYKLDYFEYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNE 425
            ..|||.|:|||.:||:||.:||.:|.:....|:|.:.|..::::..||...:..:||||||.|:.
  Fly   300 SIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDV 364

  Fly   426 SATFENFLGDSESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFL 469
            .:...|.:|:||.:..||..::....|...|:.:||||.|:|::
  Fly   365 DSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGYI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 113/317 (36%)
EcKinase 529..813 CDD:281023
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 113/317 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.