DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG10550

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:426 Identity:153/426 - (35%)
Similarity:252/426 - (59%) Gaps:25/426 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 SSEQPENPKN--QILDWLNVSDFAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQL 546
            |:|:|.||..  .|..|:|...|..:|......||||:.....:||.||:|:.|.::::.::..|
  Fly     6 SAEKPVNPNEHLHIPKWINEEYFQPIIEKDVENFDKIINLVPIAATAPGENYTSIMIRVIVDILL 70

  Fly   547 KDHTSKTFSYILK--VQPKSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVL 609
            ||.:.:..|||||  ::..|..|....:.:||||.:||:.::|.|.:|||:|||.:........:
  Fly    71 KDGSEQRVSYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHV 135

  Fly   610 NKAVKEEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNGAYPPLYNDGI 674
            :...:...::.|:|..:.||..||:||.::.|.:..|:|||:.||||:..||:||.|..:||..|
  Fly   136 DATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSI 200

  Fly   675 YIEQTRDVFHNMFASAKEAYIRIFGTF--EGADEYLPKLEWIIDNHVD--QVLEDA----KINEQ 731
            |.||:||:|.::....:|.:::....:  |.|:.|:.:: |      |  :|.|:|    :::|.
  Fly   201 YNEQSRDLFESLGKQREEQFLKAMRNWDLENAESYIARM-W------DPLEVFEEAVQVNQVDED 258

  Fly   732 AFNVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNL 796
            .||||||||.|.|||||.|...|.:..|.|:|.|..|:|:|||||:|.:.:||.||||:.|||:.
  Fly   259 EFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHF 323

  Fly   797 IRFYHENLVEHTKLLKYNGFVPSLSELHAILIEH----PAFAVGTVISTLTVCLTDEGFNPELFF 857
            |:.||:.|.|..|||.|:..:|:|.:||.:::::    |..|:|.:::||..  ||:..|.::..
  Fly   324 IQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMP--TDKDANMKMIL 386

  Fly   858 VETPESEAFRTKLLGNERYKAHVEKIMPWLNRRGLL 893
            .:.||::|.|.:...|..|...::.::|:.:.:|||
  Fly   387 AQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 114/293 (39%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 114/293 (39%)
APH 108..338 CDD:279908 93/236 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442547
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.