DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31370

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:389 Identity:95/389 - (24%)
Similarity:173/389 - (44%) Gaps:42/389 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 DWLNVSDFAEVISSAEPEFD-KIVGGSWSSATKPGDNFASKLLKIDIE--TQLKDHTSKTFSYIL 558
            :|||.....:|:.|.|.|.| ::....::..:..|||:||.:::..:|  || |...||  |.|:
  Fly    14 EWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQ-KGFFSK--SLII 75

  Fly   559 KVQPKSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVKEEYLLMENL 623
                |:..:.|....:|..|:.||:|.:|.|.::.::...|....|.. :.......:.::.|:|
  Fly    76 ----KTVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAEC-IYYSLEPSQVMIFEDL 135

  Fly   624 QTKGFKMA-DRMKGLNMEHTK--SSLKKLAQWHAASIKYKELNGAYPPLYNDGIYIEQTRDVFHN 685
            ....:.|. ||:    :.|.:  .:..|||::||.|:|.......:...:.|||.:.   |:.: 
  Fly   136 GEMDYAMVRDRV----LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLV---DIPY- 192

  Fly   686 MFASAKEAYIRIFGTFEGADEYLPKLEWIIDNHVDQ---VLEDAKINEQ-AFNVLNHGDAWINNI 746
             .:|....:....|.....|.|....|.|..:.:|:   ::::.:.|.| .:.||.|||....||
  Fly   193 -MSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNI 256

  Fly   747 MFQYDAE-GRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKL 810
            |.:::.| |..::..|||:|.......|.||.|.:......:.::.|.:.|:.:|...|.|..:.
  Fly   257 MVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRK 321

  Fly   811 LKYNGFVPS----LSELHAI-------LIEHPAFAVGTVISTLTVCLTDEGFNPELFFVETPES 863
            :.|.|.:|.    ..|::.:       |..:...:||..:.|.|...||:....   |:|..:|
  Fly   322 IGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEETDDKLQD---FIEECKS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 73/293 (25%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 73/293 (25%)
APH <202..320 CDD:279908 31/117 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459816
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.