DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG13659

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:434 Identity:101/434 - (23%)
Similarity:195/434 - (44%) Gaps:36/434 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 VAPETPSSEQPENPKNQILDWLNVSDFAEVISSAEPEFD-KIVGGSWSSATKPGDNFASKLLKID 541
            :|.|:.:.::...|     :||||....:|:...|.:.: |::..|::.|:..||::||.:.:..
  Fly     1 MAEESFNDDELNPP-----EWLNVQFMTQVLRGYEKDSNLKVINLSFTPASAKGDHYASIMFRAR 60

  Fly   542 IETQLKDHTSK----TFSYILK---VQPKSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLT 599
            :|     :|::    |.|.|:|   |:.....|.|.|..:|..|:.||.|.:|.:|::.:.|...
  Fly    61 VE-----YTAQNGNFTKSLIIKTMIVEEGIKKDMFKDSPLFTTEIGMYTKVLPEWERILRRANDP 120

  Fly   600 VTFTANSFVLNKAVKEEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNG 664
            ....... :.:.....:.|:.::|...|:.:. |.:.|..|...|:..|||:.||.|:|:.....
  Fly   121 AKLYVEC-IYHSLQPHQILIFDDLVEMGYAVV-RDRFLTREEISSAYSKLAKIHAISMKFIHEQP 183

  Fly   665 AYPPLYNDGIYIEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLP---KLEWIIDNHVDQVLEDA 726
            .|...:.:|: .|....:..::.:...:.::.:.|......:|.|   |:.....:.:.:.:::.
  Fly   184 EYLKEFKNGL-CEMPGLIDSSIISGGMDPFMEMLGRIPELSKYQPHFKKISLHFKDRLRETMQEY 247

  Fly   727 KINEQ-AFNVLNHGDAWINNIMFQYDAE-GRLKETYLLDHQNAKYGNPAQDL---YYFLISSAEL 786
            :.|.| .:|||.|.|....|:||:.:.| |..::..|||:|.......|.||   .|.|:..|: 
  Fly   248 RNNPQPGYNVLCHADFHSRNMMFKNNKETGCFEDCMLLDYQGCNVAPMAVDLMYSIYMLMGPAQ- 311

  Fly   787 DIKVDEFDNLIRFYHENLVEHTKLLKYNGFVPSLSELHAILIEHPAFAVGTVISTLTVCLTDEGF 851
              :.:|.|.|:.:|...|:|..|.:.|.|.:|:.....|.:..|..:....:.:.|.|.:   |.
  Fly   312 --RREELDILLNYYLSILLETLKKIGYQGSMPTEQGFWAEMKRHRYYEFLLLSTFLPVSI---GL 371

  Fly   852 NP-ELFFVETPESEAFRTKLLGNERYKAHVEKIMPWLNRRGLLD 894
            .. :|...:...:|..|.||...|.:....:.|:....:.|..|
  Fly   372 RTHKLDIGDMMHNEETRKKLYQLEDFMEETKSILDRFQKSGYFD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 72/298 (24%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 72/298 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459815
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.