DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31097

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:430 Identity:146/430 - (33%)
Similarity:216/430 - (50%) Gaps:41/430 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 ENPKNQIL--DWLNVSDFAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTS 551
            |||...::  .|||.|.|..:|:..||:|.||...:..:|..||.||||.:|::.::..:||.:.
  Fly     4 ENPNESLVVPKWLNKSKFESLIAKDEPDFTKIDQFTTVAAVPPGGNFASVMLRVYLDIVMKDGSQ 68

  Fly   552 KTFSYILKVQPKSTPDN--FTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVK 614
            |..||::|...:|....  ..::..|.||.:||..|:|.||::|:.||..|........:.:...
  Fly    69 KRKSYVVKTMLESDKGGKAVNEMRYFHKEQQMYSTYLPQFEKIYRVAGHPVQLMPKCLEIGEIDG 133

  Fly   615 EEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNGAYPPLYNDGIYIEQT 679
            ..|.:.|:|.|:.|..|||.||:||||.:.||:|||:.||||:.|||   .|.|.:.|       
  Fly   134 NIYFIFEDLSTRNFVAADRTKGVNMEHMRLSLRKLAELHAASVIYKE---RYGPYHAD------- 188

  Fly   680 RDVFHNMFASAKEAYIRIFGTFE-GADEYLPKLE-WIID-----------NHVDQVLEDAKINEQ 731
               |.|.|| .|:........|| .|.||...:: |.||           .:....||...::.|
  Fly   189 ---FDNGFA-RKDKIEHSVRRFEVKAPEYKAAMKTWGIDECYLKNFPTTEQYGKLCLESLNVDPQ 249

  Fly   732 AFNVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNL 796
            .||||.|||...:||:|:|:..|...|..:||.|..|:.:|.|||...:|.||..|....||||:
  Fly   250 DFNVLTHGDFSPSNILFKYNENGAPSEALILDFQICKWASPTQDLLMLIILSARKDSSYKEFDNI 314

  Fly   797 IRFYHENLVEHTKLLKYNGFVPSLSELH-AILIEHPAFAVGTVI------STLTVCLTDEGFNPE 854
            :|.|.|.|::..::|||...:|.|.||. ||..::..|:....:      ..|.||..:   |..
  Fly   315 VRIYWEYLIDFLRVLKYKKPLPQLRELQSAIYKKNNTFSAFFAVMNHLPGDLLPVCKEN---NLH 376

  Fly   855 LFFVETPESEAFRTKLLGNERYKAHVEKIMPWLNRRGLLD 894
            .|.:|....::||||:..|..:...|:::.|....|||.:
  Fly   377 TFNLEDEVGKSFRTKVYTNPIFVEVVKELYPICCNRGLFN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 106/298 (36%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 106/298 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D27900at6960
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.