DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31098

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:439 Identity:112/439 - (25%)
Similarity:198/439 - (45%) Gaps:53/439 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KSNLGPEWLNQTQFEELLAAHV-DQFSKIVGFQVKPAMAPGE--NYATLMLRISIDVELTDKSTK 118
            |:...||||.....:::|..|. ::...:....||.|....:  .:|:.|.|.|.:::.......
  Fly     6 KNYQAPEWLTAEFLQDVLKEHFKEEQLAVTELIVKSAQVGDQAAGFASEMHRASFNLQRGTAPKG 70

  Fly   119 LVCFMLKVPHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEP 183
            ....::| .|...|...:...:..|..|...|.::||:::.|.::.|.....||..:......||
  Fly    71 KFSVIVK-DHPKGQTGAVAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIAPTCYYTTESPEP 134

  Fly   184 KLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQFVNGVMGG 248
            .|    ::.|:...||:|..|...|||:.....::|:|:.||.|::..|               .
  Fly   135 FL----ILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALIAQ---------------D 180

  Fly   249 NKEVLMAFYEGMVA------SFRTALMANLK-------NFKNGEEFREKL----EKAFVQIFLDF 296
            :.|||..|.|..::      .|.|....|::       ::|..||..||:    |....:....|
  Fly   181 SPEVLEFFDEAPISRNPDRRDFLTFFPVNIRCVAEEVAHWKGYEEITEKMFNLAENVLQRALTMF 245

  Fly   297 EHLMTADPDEFNVLNHGDCWMNNLLFKLDSK-GEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHI 360
            |    :...:|.|.|..|.|:|||||.:::: .|..|::.:|||....||||.||.|.:..|::.
  Fly   246 E----STGKDFRVFNLTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNE 306

  Fly   361 DYKLDYFEYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNE 425
            :.:..:::|.:|.|...|.|.|:.|.:.|..|:|:|:|:.:.|.....|..:..:.|::.   .|
  Fly   307 NVRKVHYKYIVREYQRVLQQTLEKLNYQGHIPTLKEIHIELIKTSLMGVIGATCLTPLIF---RE 368

  Fly   426 SATFENFLGD----SESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLE 470
            .|.||| |.|    :||..:|:.....|.:|..::::.:...:..|||:
  Fly   369 GAGFEN-LEDLNSRTESGDRFRRENVENPKYRAFLQRTIKEFELSGFLD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 79/311 (25%)
EcKinase 529..813 CDD:281023
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 79/306 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.