DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31104

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:436 Identity:120/436 - (27%)
Similarity:190/436 - (43%) Gaps:60/436 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PEWLNQTQFEELLAAHVDQFS--KIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFML 124
            |.||| .||...:....:|..  |:...||.||.|.|::||::|.|..  ||.|....|.  |..
  Fly    16 PAWLN-AQFIGDILREYEQLPDLKVTDLQVSPATAQGDHYASVMFRTK--VEYTTPKGKF--FKP 75

  Fly   125 KVPHNVPQME----QMLAMANFFNSENKVYSDILPKLEELYKAKGLDIT--FAPKAFKLDSVKEP 183
            .:...:|:.|    .||:.::.|.:|..:|...||:.|.:.:..| |.|  |.|..:  .|:| |
  Fly    76 LIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAG-DNTKLFVPCIY--HSLK-P 136

  Fly   184 KLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQFVNGVMGG 248
            :  ..::..||...|: .:.|....:|...|.|..|||::||. ||.|....||   |:      
  Fly   137 R--QVMIFEDLVPQGY-TVIRDSPPSLGDLKLAFDKLAKWHAV-SMKVINEQPY---FL------ 188

  Fly   249 NKEVLMAFYE------------GMVASFRTAL--MANLKNFKNGEEFREKLEKAFVQIFLDFE-- 297
             ||.....:|            || .:|...|  |..|:.:|:  .| ||::..::| .|:.|  
  Fly   189 -KEFQYGLFEMPTIDTDPFITTGM-TNFIEMLDKMPELRKYKH--HF-EKIKDNYMQ-RLEVEMH 247

  Fly   298 --HLMTADPDEFNVLNHGDCWMNNLLFKLDSK-GEVQDMLFVDFQNPKYGSPTQDLFYLILTSVH 359
              |....: |.:.||.|||..:.|::|:.:.: |...|::.||||.......|.||.|.:...:.
  Fly   248 EYHKYRRN-DRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLME 311

  Fly   360 IDYKLDYFEYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPN 424
            .:.:.:..|..|..|...|...|..:|:.|..|:.|||...:..:..:..|.....|||::...:
  Fly   312 PEQRWEMGENLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNKYYDFFLISTFLPIMVGVKS 376

  Fly   425 ESATFENFLGDSESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLE 470
            ........|.||:  |:.|:  |....|...:.|||...:..|:.:
  Fly   377 NDLKMHEALQDSQ--ARLKS--YFLDDYVQDVYKLLTKYEQLGYFK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 86/316 (27%)
EcKinase 529..813 CDD:281023
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 86/316 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459811
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.