DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG10514

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster


Alignment Length:428 Identity:126/428 - (29%)
Similarity:209/428 - (48%) Gaps:34/428 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PEWLNQTQFEELLAAHV-DQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLK 125
            ||||.....|..|..|. |:...|...|:.||:.|||||..::.|..::..|::|...:...::|
  Fly     5 PEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNLIVK 69

  Fly   126 VPHNVPQM-EQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEPKLANTV 189
            ...:..:: ::::|..:.:|.|..:|.::|||..||....|......|.|..:|   ..::|  :
  Fly    70 TEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVD---RERMA--I 129

  Fly   190 LMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASS-MNVQVNGPYE-------DQFVNGVM 246
            :..|||..|:...:|:..||.|.|...|:|||:||||:: :|.:.:|..|       :::.|...
  Fly   130 IFEDLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYTNAYS 194

  Fly   247 GGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDF-EHLMTADPDEFNVL 310
            |       .|..|::|:.|  .|:.:....:   :.||| .|....::|. .......|.:.|||
  Fly   195 G-------YFVGGLLAAAR--WMSKVPTLAH---YGEKL-FALAPHYMDIGRECFAPTPGQVNVL 246

  Fly   311 NHGDCWMNNLLFKLD-SKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHY 374
            .|||.|.||::||.| :.|...|:|.:|||...:|||..||.:|..||:....:.|......:.|
  Fly   247 AHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFY 311

  Fly   375 HEQLTQHLDLLGFTGKQ-PSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSES 438
            |:..|:.|:.|.:...| |||.:..:.:.:...:|:..::.|.|:::......|.|...:.|.|.
  Fly   312 HKIFTETLEKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMISQDPTDACFNALMNDDER 376

  Fly   439 SAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLEAYFINQ 476
            ..:|||.||.|......:..|:|:.|.||.||   :||
  Fly   377 GIRFKNRLYNNPTVQQNLHSLVPFFDRKGLLE---VNQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 88/302 (29%)
EcKinase 529..813 CDD:281023
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 88/302 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.