DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG10513

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:429 Identity:120/429 - (27%)
Similarity:194/429 - (45%) Gaps:45/429 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PEWLNQTQFEELLA-AHVDQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLK 125
            ||||::|..|.||. ...|...:|....:|||.|.|:|||::|.|:.|             ..||
  Fly    16 PEWLDETYLERLLRDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRI-------------LFLK 67

  Fly   126 VPHNVPQMEQMLAMANFFN---------------SENKVYSDILPKLEELY-KAKGLDITFAPKA 174
            .....|:.|..:....:.|               :|.::|..|||:|..|. |.:..:..|| |.
  Fly    68 SGAKSPETEYYIVKTTYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFA-KT 131

  Fly   175 FKLDSVKEPKLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYED 239
            ..:|...|     .::..||:...:...:||...:||.|:..|:|||:.|||:::..:.......
  Fly   132 LHVDYEHE-----AIIFEDLAVTKYVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGLLT 191

  Fly   240 QFVNGVMGGNKEVLMAFY---EGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMT 301
            :|.:|:...:.:....|:   .|:.|.|.....      :.||.:..||:|...::......:..
  Fly   192 KFDHGIFNRHTQAFAPFFVNTVGVAADFARECP------ELGERYATKLKKLQERVMEYSTRVYD 250

  Fly   302 ADPDEFNVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDY 366
            ..|.:||.|.|||.|:||::.:.....|..||..:|||...:.||..||.|...|||.:|.:.:.
  Fly   251 PQPGDFNTLVHGDYWVNNVMLRYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQ 315

  Fly   367 FEYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFEN 431
            .:...::||..|.:.|..|.|.|..|:||:..:.:.:...:||..::....|:..|.|..|.|..
  Fly   316 QDALFQYYHTVLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQNADADFNA 380

  Fly   432 FLGDSESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLE 470
            .:.|.|....|:.:||||||....:::.||..|..|.|:
  Fly   381 LMKDDERGRNFRKVLYTNKRLQDNLKRELPRFDRSGLLD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 80/310 (26%)
EcKinase 529..813 CDD:281023
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 80/310 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.