DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG11878

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster


Alignment Length:422 Identity:122/422 - (28%)
Similarity:212/422 - (50%) Gaps:19/422 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KSNLGPEWLNQTQFEELLAAHV-DQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTK-- 118
            |.:..|.||.....::.|..:. |...|:.....|||:|.|.||.::|.|  |:||.|.|.:|  
  Fly     8 KVHPAPVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTR--INVEYTTKVSKGK 70

  Fly   119 -LVCFMLKVPH-NVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVK 181
             ...|::|... :......:|.....:..|..:|..|||:|.::.:.:..|   :.|.|.. ::.
  Fly    71 QSTTFLVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKD---SRKLFAA-TMN 131

  Fly   182 EPKLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVN-GPYEDQFVNGV 245
            ..:..::::..|:|.|.:|...|.:.|:||.|...|:|||.||||||:..:.. |.::..:..|.
  Fly   132 VDRERDSIIFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGF 196

  Fly   246 MGGNKEVLMAFYEGMVASFRTALMANLKNFKN-GEEFREKLEKAFVQIFLDF-EHLMTADPDEFN 308
            .  ||..  ..|..::.:...||..:|.:.:. |:.::.|::: .|:..:|: |...|:.|.:|.
  Fly   197 F--NKHT--RAYAPIMTNLLEALSRSLASDEELGQRYKAKIDR-LVERLMDYGERSTTSSPGDFL 256

  Fly   309 VLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRH 373
            .|.|||.|..|.:|:.|:|....:.:|:|||...:.||..||.|...||:..:.:|::....::.
  Fly   257 TLAHGDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQF 321

  Fly   374 YHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSES 438
            |:.:||:.|..|.:.|:.|||.:..:.....|.:|||.|:...|::..:..|.|:.|..|..|||
  Fly   322 YYYRLTEALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKEDASIEQVLSSSES 386

  Fly   439 SAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLE 470
            ..:|||.:|.::.....:...||:||..|.|:
  Fly   387 GMRFKNSVYESENIKKKLSVTLPFLDQFGLLD 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 84/298 (28%)
EcKinase 529..813 CDD:281023
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 84/298 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.