DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG14314

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:401 Identity:96/401 - (23%)
Similarity:181/401 - (45%) Gaps:60/401 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 LNVSDFAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKTFS------YI 557
            |::..|.::....||:. :|.....:..:..|||:.:.|.:|.:       |.|..|      .|
  Fly    26 LSLEVFQDIFKHVEPDV-QIDAFELAQGSDRGDNYTAALYRIKL-------TGKRRSLKWEQNVI 82

  Fly   558 LKVQPKS--TPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTA--NSFVLNKAVKEEYL 618
            .||.|:|  ..:.:....:|..|::.|...:|  |.|...|..|...|.  |:.....:.:.:.|
  Fly    83 CKVMPESVVAREAYKSDKLFRNEVQFYNTIMP--ELLKFQASKTNQDTPVFNAIPKCYSARHDLL 145

  Fly   619 LMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYK-----ELNGAYPPLYNDGIYIEQ 678
            :||:|:.:||:|:||.|||::|.|:|.|.::||.|..|:.||     |.:... .:.::||:...
  Fly   146 IMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLC-SMISEGIFCTA 209

  Fly   679 TRDVFHNMFASAKEAYIRIFGTFEGADEYL-PKLEWIIDNHVDQVLEDAKI---------NEQAF 733
            ....:.|.:....:..|::      ..|.| |..::::  .:::..|.:..         .|...
  Fly   210 NTSWYRNYYERLTKNAIQM------VSEVLPPDSKYVL--AMNKFAESSSFFGRMVKLASTESPL 266

  Fly   734 NVLNHGDAWINNIMFQYDAEG--RLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNL 796
            :.:.|||.|:||.::.||.|.  |:.|..|||.|..:|.:.|.|:...|......:::..:...|
  Fly   267 SAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTL 331

  Fly   797 IRFYHENLVEHTKLLKYNGFVP----SLSELHAILIE----HPAFAVGTVISTLTV--CLTDEGF 851
            ::.|.|.|....::|..|  :|    :|.:|..:..|    :..||:|..:..|.:  |.:::. 
  Fly   332 LKIYTEELFRWLQMLCTN--LPDHCDTLQKLQDLFAEELKTYGRFALGLALDILPISTCSSEDA- 393

  Fly   852 NPELFFVETPE 862
             |:::...:.|
  Fly   394 -PDMYLDRSDE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 79/310 (25%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 78/307 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.