DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG5644

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:472 Identity:109/472 - (23%)
Similarity:181/472 - (38%) Gaps:119/472 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QFEELLAAHVDQF---SKIVGFQV-----KPAMAPGENYATLMLRISI-------DVELTDKSTK 118
            |:|| .|.|:.|.   ||:|.|.:     ....:.|:||.:::.|::|       |.||.  .::
  Fly    31 QYEE-NAEHLRQLFSQSKLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELA--GSE 92

  Fly   119 LVCFMLKVPHNVPQMEQMLAMANFFNSENKVYSDILPKL-----EELYK----AKGLDITFAPKA 174
            :|..::|.........|:......|::|...|..:.|.|     .:|:.    |:..|...|...
  Fly    93 IVTVIVKRQIASLSRRQLYRCEEAFSNEINAYRHLAPLLAAHSRHQLFPVCHIAESQDRRDAEGG 157

  Fly   175 FKLDSVKEPKLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGP--- 236
                   ||    .:::.||...||:..:||..|.|......:|||||.||||....::...   
  Fly   158 -------EP----IIVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSFA 211

  Fly   237 ----------YED---------------QFVNGVMGGNKEVLMAFYEGMVASFRTALMANLKNFK 276
                      |.|               |.:..:...|.:..:.....::...||.|..|||:..
  Fly   212 FHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTNLFENLKHEI 276

  Fly   277 NGEEFREKLEKAFVQIFLDFEHLMTADPDEFNVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNP 341
            |.                     ..|.|:  :|:.|||.|:||::|    :.|.::::|.|.|..
  Fly   277 NA---------------------TAAAPN--SVICHGDLWVNNIMF----RSEPEEVIFFDLQAM 314

  Fly   342 KYGSPTQDLFYLILTS-------VHIDYKLDYFEYF----IRHYHEQLT--QHLDLL--GFTGKQ 391
            :..||..|:.:.|.||       ||.|..|..:...    :||..|..|  :.|:.|  .|:.::
  Fly   315 RKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQR 379

  Fly   392 PS---LRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSESSAKFKNLLYTNKRYH 453
            .|   :|::|..: ..|.|       :||.|..|||.....:.....:.:..:.|........||
  Fly   380 LSSDYVRQVHYGL-AIGMW-------ILPAVTFDPNNLPNLDVMSEQNLTGKEIKCTQMLTSEYH 436

  Fly   454 GYIEKLLPWLDNKGFLE 470
            ..|.:|:......|:|:
  Fly   437 MRIRELVMEFYELGYLQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 80/350 (23%)
EcKinase 529..813 CDD:281023
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 74/331 (22%)
P-loop_NTPase <357..435 CDD:304359 18/85 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.