DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG11889

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:425 Identity:120/425 - (28%)
Similarity:207/425 - (48%) Gaps:19/425 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PIEKSNLGPEWLNQTQFEELLAAHV-DQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTD-KS 116
            |.:.::..|.||.:...|:.|..:. :....:....:|||.|.|||||::|.|||::....| |.
  Fly     2 PEKTTHNAPAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKD 66

  Fly   117 TKLVCFMLKVPH-NVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSV 180
            .:...|:||... :......:|.....:..|..:|..|||:|.::.|.:..|   :.|.|.. :|
  Fly    67 NQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHD---SRKLFAA-TV 127

  Fly   181 KEPKLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVN-GPYEDQFVNG 244
            ...:..::::..|||.:.:|...|::.|:||.|...|:|||.||||.:...|.. |.:|..:..|
  Fly   128 GVDRERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRG 192

  Fly   245 VMGGNKEVLMAFYEGMVASFRTALMANL---KNFKNGEEFREKLEKAFVQIFLDF-EHLMTADPD 305
            ..  ||.|  ..||.::.:...||...|   .:.|  |.::.|::: .:...:|: |...:..|.
  Fly   193 FF--NKHV--RGYEPIMKNILKALSRTLDLSPDLK--ERYQAKIDR-LIDNVMDYGERSTSVAPG 250

  Fly   306 EFNVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYF 370
            :|..|.|||.|..|::|:.|.:|...:.:|:|||...:.||..||.|...||:|.:.:|:.....
  Fly   251 DFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTEL 315

  Fly   371 IRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGD 435
            ::.|..:|...|:.:.::||.|||.|........|.:|||.|:...|.::.:..|..:.|.|:..
  Fly   316 VQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTS 380

  Fly   436 SESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLE 470
            .|...:.::.:|..:.....:...||:||..|.|:
  Fly   381 DEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 87/298 (29%)
EcKinase 529..813 CDD:281023
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 87/298 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.