DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and JhI-26

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:425 Identity:92/425 - (21%)
Similarity:164/425 - (38%) Gaps:106/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 DNFA-SKLLKI---DIETQLKDHTSK---TFSY-----------------ILKVQPKSTPDNFTD 571
            ||:: ||:...   ||:..:..|:..   ||.|                 ::|..|...|:.:..
  Fly    27 DNYSESKVTTFHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDGQKFQRKMVVKKTPAMPPEMYES 91

  Fly   572 VN---MFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVKEE------YLLMENLQTKG 627
            :.   :|..|:..|.:.:|.|::          ||...|...|....|      ..::||...:|
  Fly    92 IQFGPLFTNEINFYTEILPEFQK----------FTDGKFAAPKYYYGELNQHSAVAILENFAEQG 146

  Fly   628 FKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNGAYPPLY-------------NDGIYIEQT 679
            :::.....||:::|...::..|.::|..:...|..|   |..:             ||.|:.|..
  Fly   147 WRVTKDRVGLSLQHAMIAVSYLGRFHGFAYAMKHKN---PEKFAQLTDNLKESRYANDNIHPEWK 208

  Fly   680 RDVFHNMFASAKEAYIRIFGTFEGA--DEYLPKLEWIIDNHVDQVLEDAKINEQAFNVLNHGDAW 742
            ..:..::..:||..     .|::..  :|::.|..::|.:: .|.........:....|.|||..
  Fly   209 LTMKTSIDRAAKAV-----ATYQPQIDEEFVKKFCFMISDY-SQYGRQRVAPREPLATLCHGDYV 267

  Fly   743 INNIMFQYDAEGRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNLIRFY----HEN 803
            .||:.::||.:...:|..:.|:|..:..:|..||..||..|...:::...|:.:...|    |.:
  Fly   268 RNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNS 332

  Fly   804 LVEHTK-----------LLK-YNGFVP-SLSELHAILIEHPAFAVGTVISTLTVCLTDE-GFNP- 853
            ..||.|           ||| |..|:| |||                :.::..:.|.|. ..:| 
  Fly   333 YREHAKEEVPDFLSRGELLKEYVRFLPYSLS----------------ISASFLMSLVDPLDISPE 381

  Fly   854 ELFFVETPESEAF-RTKLLGNE---RYKAHVEKIM 884
            |:|.::..:.|.. ||...|.|   |..||..|.|
  Fly   382 EMFALQLSDEEIIERTMNRGGEVVDREVAHQVKEM 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 71/345 (21%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 57/294 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.