DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG9259

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:428 Identity:106/428 - (24%)
Similarity:169/428 - (39%) Gaps:91/428 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 FAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKT------FSYILKVQP 562
            |.:.:|:::..||.:......::..|.....|.|.   :...||.|.|:.      ||....|..
  Fly    20 FHQDVSNSDTGFDIVNYTLKPTSDAPAGYLGSHLY---LHVTLKLHNSEEVRQLTFFSKSAPVGN 81

  Fly   563 KSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVKE----------EY 617
            :|..:...|..:|.||:.:||..:|.                    |:||..|          ..
  Fly    82 ESRMEYLEDFGVFEKEIAVYQNVLPD--------------------LHKACAEVAPKCYYADKNL 126

  Fly   618 LLMENLQTKGFKMADRMKG-LNMEHTKSSLKKLAQWHAASIKYKELNG--------------AYP 667
            |:.|||..:|::|.....| |..|.....||.||..||.||..::..|              |||
  Fly   127 LIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYP 191

  Fly   668 PLYNDGIYIEQTRDV-FHNMFASAKEAYIRIFGTFEGADEYLPKLEWIIDNHVDQ---VLEDAKI 728
                ..:..|..|.| |.|.....|| :|::.      .:|..||:::::|..::   :.|..|.
  Fly   192 ----SDVSPEHMRMVNFQNACLVLKE-FIKLI------PKYQSKLDYVLENFTEKMSFIFEAVKT 245

  Fly   729 NEQAFNVLNHGDAWINNIMFQYDAEGRLK-ETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDE 792
            ::...|.:.|||.|.|||||||...|.:. :..|:|.|.|:|..|..|:...|......:.:...
  Fly   246 SDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAH 310

  Fly   793 FDNLIRFYHENLVEHTKL--LKYNGFVP------SLSELHAI-LIEHPAFAVGTVI---STLTVC 845
            ...|:..|:..:.|..|.  |....|:|      |:.:..:: |||...|....::   .|..:.
  Fly   311 LSELLAEYYRFMTEFLKRADLDIARFIPEQTFYESVQKFRSVGLIESCLFCHLVILPPHCTQKLT 375

  Fly   846 LTDEGFNPELFFVETPES---EAFRTKLLGNERYKAHV 880
            .:.:|||.  ||......   |||.|    :|.|::.:
  Fly   376 SSVDGFND--FFTNKRIEICLEAFNT----DELYRSRL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 83/321 (26%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 78/301 (26%)
APH <252..325 CDD:279908 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459713
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.