DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and F59B1.10

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:369 Identity:96/369 - (26%)
Similarity:149/369 - (40%) Gaps:88/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDS--VKEPKL-ANTVLMSDLS 195
            |||.|   :|.|..|             |....::.|...|.|.:|  :..||: ..|.|....|
 Worm   107 EQMYA---YFESSCK-------------KMHNQEMNFYEVAGKFNSKTLLIPKVYFYTKLDEKNS 155

  Fly   196 QDGFKNLNRLE----------CLNLEQTKFALKKLAQFHAASSMNVQVNGPYE-----DQFVNGV 245
            ..||..:..:|          | .:|:.:..|:.:|:..|.|..|     |.|     .:..||.
 Worm   156 NKGFIGMEYVEGSIVRHSYDTC-TIEEIQPILRAIAKLQALSLQN-----PAEISKDLQKIDNGA 214

  Fly   246 MGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFE---HLMTADPDEF 307
            :......:|....|:...|...  .||:..:.||:. :::|:...:| ||||   :|......:.
 Worm   215 IFQETLKMMLSESGIKGIFEQC--RNLERSRFGEKV-DRIEEKRNEI-LDFEKAFNLNKVVGIKQ 275

  Fly   308 NVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSV-------HIDYKLD 365
            |||.|||.|..|.|: .::.|.......||:|....|:|.:||..|:::::       |....|:
 Worm   276 NVLCHGDLWAANFLW-TENNGVFCATRIVDYQMSHLGNPAEDLVRLLVSTITGADRQAHWQQILE 339

  Fly   366 -YFEYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIV-LLDPNESAT 428
             ::.||           |:.|| :|:.|...|...|.:|    ..|| :|.|.:: |..|...|.
 Worm   340 QFYSYF-----------LNELG-SGEAPYTLEQLKLSFK----LYFP-VGALALLPLFGPAVDAK 387

  Fly   429 FENFLGDSESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLEAY 472
            .|..  |||.:.|.:         |..|||:...||:   ||.|
 Worm   388 LEGM--DSEKAEKCR---------HVVIEKVACLLDD---LEKY 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 69/281 (25%)
EcKinase 529..813 CDD:281023
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 96/369 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.