DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG9498

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster


Alignment Length:433 Identity:110/433 - (25%)
Similarity:201/433 - (46%) Gaps:43/433 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PEWLNQTQFEELLAAHVDQFSKIVGFQVKPAMA--PGENYATLMLRISI------DVELTDKSTK 118
            ||:||:..|.|.|...:.: ||:...::..|..  ||:||.:.:.|:.:      |...:..:.:
  Fly    13 PEYLNEHFFTETLEEGLRE-SKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGESPVTEQ 76

  Fly   119 LVCFMLKVPHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEP 183
            |...:..:|  :.:..|.|.....|..|.:.|:|:||:|:.|.:..    ||..|.:  .|||.|
  Fly    77 LSLIVKTIP--ITEATQFLEDVCVFIKEKQTYTDVLPRLDILSRGD----TFGAKYY--HSVKTP 133

  Fly   184 KLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQFVNGVMGG 248
              ..|::.|||:.:|||..:|.:.|:.......|::|.:|||.|.:..:.:.....|:..|::  
  Fly   134 --VQTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGML-- 194

  Fly   249 NKEVLMA--FYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMTADP-----DE 306
            ::::||.  .:|.|...|...|:.:..::..    .||:.|...::..:|.::....|     |.
  Fly   195 SEDILMKSDTFEQMFGGFLKGLIKSSASWAG----YEKISKHLQRLMDNFRNVCADAPRPRKGDR 255

  Fly   307 FNVLNHGDCWMNNLLFKLDSKGEVQDM----LFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYF 367
            :.||||||.|.||.::..|:..: .|:    :|||||...||||..||.:.:.||:.:....:..
  Fly   256 YVVLNHGDLWTNNFMYGYDNASQ-PDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERR 319

  Fly   368 EYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESA---TF 429
            |..|:.|:......|:...|. ..||..:|...:....::.:|.....||::.: |.|.|   :.
  Fly   320 EELIKVYYASFKDALEYARFE-DIPSYEDLQYELRSRETYGLFGMFAFLPMITM-PKELAQDNSI 382

  Fly   430 ENFLGDSESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLEAY 472
            ||...::....|. :.:::.|..:.:.:..|...|:.|....|
  Fly   383 ENMQDEAFKQRKM-DAIFSQKFLNDHQKWALKRADSLGVFGDY 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 82/308 (27%)
EcKinase 529..813 CDD:281023
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 82/308 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459237
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.