DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG33510

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:439 Identity:83/439 - (18%)
Similarity:142/439 - (32%) Gaps:155/439 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 VLPIVLLDPNESATFENFLGDSESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLEAYFINQVVA 479
            :|..:|.|.||.....||                         .::|..::.|||..||      
  Fly    27 ILANLLADKNEQGVLLNF-------------------------NIVPATEHTGFLGEYF------ 60

  Fly   480 PETPSSEQPENPKNQILDWLNVSDFAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIET 544
             ......|.|:.|:.....|.|.  :.:..:|..||                 :..|:..|:.|.
  Fly    61 -HLYFQYQLEDQKDVQTSRLFVK--SVIFQNANMEF-----------------YMEKMGLIEKEI 105

  Fly   545 QLKDHTSKTFSYILKVQPKSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVL 609
            :|.|                          ...|::.:.|:|               ::|..:..
  Fly   106 KLYD--------------------------LLNELKKFSKHV---------------WSAKCYFT 129

  Fly   610 NKAVKEEYLLMENLQTKGF-KMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNGAYPPLYNDG 673
            .|    :..:|:|::..|: .:....:.||.......||.||..||:||.|::..|       ..
  Fly   130 RK----DLFVMQNVEDMGYVALPPGTRFLNENQMGPILKSLATLHASSIAYEKQQG-------KT 183

  Fly   674 IYIEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLPKLEW-----------------IIDN---- 717
            |.:|     |....   ||..:.            |::||                 ::||    
  Fly   184 IGVE-----FRKWL---KEVSVD------------PEVEWYTTGLRAVLAVAAIHPDVLDNPEAQ 228

  Fly   718 -HVDQVLED------AKINEQAF--NVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPA 773
             ::.|.|..      ..:|....  ||..|.|||..|: |.:..:...:.:.|:|.|..:|..||
  Fly   229 EYIAQELPRCLDKVYCMVNPSPVHRNVFVHRDAWNANV-FYHKEKPHEERSILVDFQLCRYSPPA 292

  Fly   774 QDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKLLKYNGFVPSLSE 822
            .|.:.....:.|...:.....:||..|::.|.|..:.:..|.:...||:
  Fly   293 MDFHLVTYLNLEPFSRKKMIGSLIETYYDALAEEFREMGVNPYQEQLSK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 59/314 (19%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 49/222 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459711
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.