DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG33511

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:409 Identity:101/409 - (24%)
Similarity:173/409 - (42%) Gaps:59/409 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLAAHVDQFSK-IVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLKVPH-NVPQMEQ 135
            |:.:.||..|| ::|:.       ||.|   .|.:..:|:...|...|..|:..:|. |.||.|:
  Fly    27 LINSQVDAGSKDLMGYM-------GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREE 81

  Fly   136 MLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEPKLANTVLMSDLSQDGFK 200
             ......|..|:.:||.||||::: |..|.|    .||.:...:       :.:::.||:|| ::
  Fly    82 -CERKGVFQKESALYSQILPKIQK-YATKKL----YPKCYYSRN-------DILVLEDLTQD-YR 132

  Fly   201 NLNRLECLNLEQTKFALKKLAQFHAAS-----SMNVQVNGPYEDQFVNGVMGGNKEVLMAFYEGM 260
            :|...|...|:..|..|:.|::.||||     ..||::...|::..:...:..|....:...:.:
  Fly   133 HLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAI 197

  Fly   261 VASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMTADPDEFNVLNHGDCWMNNLLFKLD 325
            |  |..|...:.:..|.....::||    ..:....|.|:.......|||.|.|.|.:|:::..:
  Fly   198 V--FLAARNPHFQTMKAQNFIQDKL----YNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFN 256

  Fly   326 SKGEV--QDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHYHEQLTQHLDLLGFT 388
            .:..|  .....||||..:|.|||.|:.:|:......:.:...::..:.||::.|..|||.||..
  Fly   257 KESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLD 321

  Fly   389 ---------GKQPSLRELHMLMYKHGSWAVF-PSIGVLPIV--LLDPNESATFENFLGDSESSAK 441
                     .|:.....|..|:.    ||:. |...:.|.:  .|...|...|:.:|....|.. 
  Fly   322 KNLITENNFRKECQRTRLAALVI----WALTEPQTKMSPSISNRLRSEEPEKFDYYLNCDRSEL- 381

  Fly   442 FKNLLYTNKRYHGYIEKLL 460
               ||...:...||.|.::
  Fly   382 ---LLRVIEIQPGYEETIM 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 77/299 (26%)
EcKinase 529..813 CDD:281023
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 77/307 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.