DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31974

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:408 Identity:97/408 - (23%)
Similarity:172/408 - (42%) Gaps:67/408 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 ENPKNQILDWLNVSDFAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKT 553
            |.||        :.:..:||....||...:...|.|..||||||:.|.:|.:..:.:..|...:.
  Fly     3 EVPK--------IKNLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRD 59

  Fly   554 FSYILKVQPKSTPDNFTDVNMFPK-----EMEMYQKYVPAFEQLYKDAGLTVTFTANSF------ 607
            ...|.|: |..|.|.:..: ..|:     |..:||...|..::|..::|:......:.|      
  Fly    60 LPLIAKL-PPLTNDLYWQI-FQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGS 122

  Fly   608 ---VLNKAVK---EEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNGAY 666
               :.|:|.|   :..|:.||:.|:|::..:|.:..|:..|...|..|||:||..|..:      
  Fly   123 RVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALR------ 181

  Fly   667 PPLYNDGIYIEQTRDVF--HNMFASAKEAYIRIFGTFEGADEYLPKLEWIID-----NHVDQVLE 724
              |....:|.|..|..|  .:|.::..:|...|..     .|.|..::.:..     |.|.::|:
  Fly   182 --LKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMN-----KEILKDIKLVTSDERDVNRVKELLD 239

  Fly   725 -------DAKINEQAFNVLNHGDAWINNIMFQY---DAEGRLKETYLLDHQNAKYGNPAQDLYYF 779
                   ...:::..|..|.|||.||||:|.:|   ..||...:..::|.|.|:||:...|:.:.
  Fly   240 IFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFV 304

  Fly   780 LISSAELDIKVDEFDNLIRFYHENLVE-------HTKLLKYNGFVPSLSELHAILIEHPAFAVGT 837
            |.||.::::..|.|.|.:..|:...::       .|....|..|:..:.:...:.:.|..|.:..
  Fly   305 LFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKV 369

  Fly   838 VI---STLTVCLTDEGFN 852
            ::   ||:.....|..|:
  Fly   370 ILADNSTIPKDYKDVDFS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 78/324 (24%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 77/316 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459632
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.