DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG7135

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:411 Identity:99/411 - (24%)
Similarity:182/411 - (44%) Gaps:18/411 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 WLNVSDFAEVISSAEPEFD-KIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKTFSYILKVQ 561
            :|....|...:.....:.| :::|...::.|:.|:|:.|.:.:..|:.:..:..:...|.|:|..
  Fly    11 YLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLIVKSM 75

  Fly   562 PKSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDA--GLTVTFTANSFVLNKAVKEEYLLMENLQ 624
            |.........::::.||...|....|..|.|...|  ..:....|.....:....|:.:::|:|.
  Fly    76 PDEKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQTIILEDLC 140

  Fly   625 TKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKE-----LNGAYP--PLYNDGIYIEQTRDV 682
            ..|:::..|..||:.:|....:.|||::||.::...|     :...||  .|:.|.|..|.    
  Fly   141 AAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDAINSEP---- 201

  Fly   683 FHNMFASAKEAYIRIFGTFEGADEYLPKLEWIIDNHVDQVLEDAKINEQAFNVLNHGDAWINNIM 747
            |..:|.:.......:.|..||......||....::..::||:.........|||||||.|:|||.
  Fly   202 FKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHGDLWVNNIF 266

  Fly   748 FQYDAEGRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKLLK 812
            |:||||..:::..::|.|...||:...|:.|||.:|.||::..|....|:..|:.:||:..|.|.
  Fly   267 FKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLP 331

  Fly   813 YNGFVPSLSELHAILIEHPAF----AVGTVISTLTVCLTDEGFNPELFFVETPESEAFRTKLLGN 873
            ::..:||..::...:.:..|:    |.|.......:.:..|..:.:.|..||...:..:....||
  Fly   332 WSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHDETFARQKVQLMFEGN 396

  Fly   874 ERYKAHVEKIMPWLNRRGLLD 894
            .|....::..:..|:...|.|
  Fly   397 TRTLESLKCTLKRLDELKLFD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 79/292 (27%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 78/290 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459253
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.