DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31102

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster


Alignment Length:421 Identity:137/421 - (32%)
Similarity:219/421 - (52%) Gaps:30/421 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PEWLNQTQFEELLAAHVDQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLKV 126
            |.|:|:..|:.||.....:|.:|:...:.||..|||.|.:|::||.||:||.|..::...:::|.
  Fly    17 PAWINEAYFKRLLKREFREFRRILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQQKSYIVKT 81

  Fly   127 PHNVPQMEQMLAMA----------NFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVK 181
                     ||..|          |.|..|..:|..|:|.||:||:..||.:.||||....:.:|
  Fly    82 ---------MLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDIK 137

  Fly   182 EPKLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQFVNGVM 246
            .   ...::..||....::|:|||:..::......|:|||:||||.::..|..||:.|.|....:
  Fly   138 G---RICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYL 199

  Fly   247 GGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKA--FVQIFLDFEHLMTADPDEFNV 309
            ..|.:...: |:..:.|::||:.:  ....:.|::..::..|  |||   .:......:|.||.|
  Fly   200 PANYQKSKS-YQARLQSYKTAIAS--WGLADHEQYVSRIPTADQFVQ---SYASCFNNNPQEFKV 258

  Fly   310 LNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHY 374
            |||||.|.:|::......|::..:.|||||..|:|||.|||:.||:.|.....::.||:||||.|
  Fly   259 LNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIY 323

  Fly   375 HEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSESS 439
            |..|.:.|.:|.::.:.|.||||||.|.|:|.|..|.:...|..:||.|:..|:........|..
  Fly   324 HTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQPGEEG 388

  Fly   440 AKFKNLLYTNKRYHGYIEKLLPWLDNKGFLE 470
            .:|::.:|||..|......:.|:|..:|.|:
  Fly   389 DRFRSKVYTNPLYVRSALSIFPFLLRRGILD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 100/303 (33%)
EcKinase 529..813 CDD:281023
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 100/303 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442552
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.