DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31099

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:418 Identity:134/418 - (32%)
Similarity:221/418 - (52%) Gaps:35/418 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PEWLNQTQFEELLAAHVDQFSKIVGFQVKPAMAPGENY-----ATLMLRISIDVELTDKSTKLVC 121
            |:|::.....:.:.:.::.     |.|: .::.|..:.     .|::|.|.:.|:|.|.:.|.:.
  Fly     7 PDWVSSLSLNQAVHSVLED-----GVQI-TSVIPSVHLIQFRNCTVLLPIQVKVQLRDFTMKKLF 65

  Fly   122 FMLKVPHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLD-SVKEPKL 185
            |:||..|.......::.....|..|::||.::||||||:|:..|..::|.|:||:|| |:.    
  Fly    66 FLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIG---- 126

  Fly   186 ANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQFVNGV-MGGN 249
            ...||:.||....:||:.|....|....|..|||||||||||::.|:.:|.:.:..|||| ...|
  Fly   127 VQYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKAN 191

  Fly   250 KEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKL---EKAFVQIFLDFEHLMTADPDEFNVLN 311
            :.||....:..:      .::.|:.::.|:.|.::|   ||..|...|   .|.:.|.:||||||
  Fly   192 ESVLQELNDPEI------FLSQLRRWRLGDHFHKRLVEKEKDLVDGLL---KLHSPDSNEFNVLN 247

  Fly   312 HGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHYHE 376
            |.|||:||::||.|..|.|:|...:|:|..|||||..||:|.||:|...|.||..|:..:::|..
  Fly   248 HSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFY 312

  Fly   377 QLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSESSAK 441
            .|..:|..|.|.|..|.|:.:...:.|:|..|.......|||.:::..|....|.:      ::|
  Fly   313 HLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNERY------ASK 371

  Fly   442 FKNLLYTNKRYHGYIEKLLPWLDNKGFL 469
            .|..::|:::|...|:.:|||::.:..|
  Fly   372 MKCAMFTSRKYIQAIKDILPWMEERSLL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 109/301 (36%)
EcKinase 529..813 CDD:281023
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 108/291 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.