DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31436

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:430 Identity:111/430 - (25%)
Similarity:198/430 - (46%) Gaps:34/430 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 SEQPENPKNQILD-------WLNVSDFAEVISSAEPEFD-KIVGGSWSSATKPGDNFASKLLKID 541
            |..|:|  ||..|       |||....|.|:...|.|.. |::..::|.|:..||::||.:.:..
  Fly     2 SGNPQN--NQFNDDELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRAR 64

  Fly   542 IE-TQLKDHTSKTFSYILKVQPKS---TPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTF 602
            :: |..|....|  |.|:|..|::   ..|......:|..||.:|.|.:|.||::.:..|.....
  Fly    65 VKYTNRKGEFQK--SLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQL 127

  Fly   603 TANSFVLNKAVKEEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNGAYP 667
            ..|. :.:.....:.|:.|:|...|: :..|.:...::..:....|||:|||.|:|.:.....:.
  Fly   128 YVNC-IYHSLEPHQVLIFEDLAEMGY-IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFL 190

  Fly   668 PLYNDGIYIEQTRDVFHNMF-ASAKEAYIRIFGTFEGADEYLPKLEWIIDNHVDQVLEDAK---- 727
            ..|..|::  :...|.::.| .:..|.::.:.|.....::|.|..|.|.|:.:::::|:.|    
  Fly   191 ESYTHGLF--EMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLERLVEEWKDIRK 253

  Fly   728 -INEQAFNVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVD 791
             ..:..:.||.|||..:.||||::.....|::..|||.|.:.......||.|.:....|.:.:.:
  Fly   254 SQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWN 318

  Fly   792 EFDNLIRFYHENLVEHTKLLKYNGFVPSLSELHAILIEH---PAFAVGTVISTLTVCLTDEGFNP 853
            .:|:||.:|...|.:..|.:.|.|.:||.|.|...|.:|   ..|.:.|.: .|...|.|:..: 
  Fly   319 NWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFL-PLMWALRDKSVD- 381

  Fly   854 ELFFVETPESEAFRTKLLGNERYKAHVEKIMPWLNRRGLL 893
               |.:..::|..|.|...::.|...|..::..|::.|||
  Fly   382 ---FGDLLQNEEKRRKCSFSKGYIKEVTILLARLDQLGLL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 72/293 (25%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 72/293 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.