DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG31288

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:424 Identity:144/424 - (33%)
Similarity:234/424 - (55%) Gaps:29/424 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 NPKNQIL--DWLNVSDFAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSK 552
            ||...::  ||:|...|..|::..||:..|::..:..:|..||:||.|.:|::.|:.::||.:.|
  Fly     9 NPNEHLIIPDWINEKYFESVLAKDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDGSVK 73

  Fly   553 TFSYILKVQPKSTPD--NFTDVN---MFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVLNKA 612
            |.:||.|..   .|:  ..:|:|   :||||..||:.|:||||.||||.|..:..........:.
  Fly    74 TKTYIFKTM---LPEERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLHTEER 135

  Fly   613 VKEEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNGAYPPLYNDGIYIE 677
            ..:.:.:.|:|..|.||..||.|||:|||....|:|||::||||..|:||:|.||..:::| :::
  Fly   136 EGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSEFSEG-FVK 199

  Fly   678 QTRDVFH-NMFASAKEAYIRIFGTF--EGADEYLP-----KLEWIIDNHVDQVLEDAKINEQAFN 734
            :....|| :.|...::||.:...::  :.||:|:.     |..|.      |.|...::|...|:
  Fly   200 KDVKKFHVDGFQLKEKAYKKAMLSWGLKDADKYIKAFPTVKQYWA------QCLSTLELNPDEFH 258

  Fly   735 VLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNLIRF 799
            ||||||.|.:|:|..|..:|.|::..|:|.|...:|:||.||.:||..|...|:::.|||:.:|.
  Fly   259 VLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRI 323

  Fly   800 YHENLVEHTKLLKYNGFVPSLSELHAIL--IEHPAFAVGTVISTLTVCL--TDEGFNPELFFVET 860
            |.|.|||..|:||....:|.|.:|...:  ..|..:|..::::.|.:.|  ||:..|.......|
  Fly   324 YWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNHLPIILFPTDKDSNIHNLSANT 388

  Fly   861 PESEAFRTKLLGNERYKAHVEKIMPWLNRRGLLD 894
            .|.|.:|.:||.|..:...::.:.|:|..||:|:
  Fly   389 EEGENYRLRLLSNPAFGNVMKDLYPFLYNRGILN 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 110/296 (37%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 107/290 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442546
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12411
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D27900at6960
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.