DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG2004

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:405 Identity:86/405 - (21%)
Similarity:160/405 - (39%) Gaps:92/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 FAEVISS-AEPEFDKIV---GGS------WSSATKPGDNFASKLLKIDI-----------ETQLK 547
            ||::.:. :|...|:|:   ||:      :..:.|.||.:.|::.:|.|           |.||:
  Fly     7 FADISAKFSEATLDEIIRNAGGTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLE 71

  Fly   548 DHTSKTFSYILKVQPKSTPDN------FTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANS 606
                      :.|..|:.|||      |..|..|..|:..|.|.:||.|...|..          
  Fly    72 ----------ISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSR---------- 116

  Fly   607 FVLNKAVKE-----------------EYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHA 654
               ..|.|:                 :::.:|::..:|::...|...:::|....:::.|.::|.
  Fly   117 ---QPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHG 178

  Fly   655 ASIKYKELN--------GAYPPLYNDGIYIEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLP-- 709
            .::.:..|:        |:....|    |.|.||:.:......|:..      ..:...:..|  
  Fly   179 VALAFNALDSKNFEKAAGSLEETY----YGEHTREWYTGFLLLAENV------ATDAVKQIYPNS 233

  Fly   710 KLEWIIDNHVDQVLEDAKIN----EQAFNVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYG 770
            |.|.:..|.:...|.|..||    ....:|..|||.|..|.:.:|:..|:.:|..::|.|.|:..
  Fly   234 KYETVATNFLQPPLFDDLINLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCS 298

  Fly   771 NPAQDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKLLKYNG-FVPSLSELHAILIEHPAFA 834
            :.|.||.:|:.|....:::...:|.|:|.|.|:..:..:.|..|. .:.|...|...|.....|.
  Fly   299 SLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIISWESLQEELKNFGRFG 363

  Fly   835 VGTVISTLTVCLTDE 849
            .|..|.:|.:.:.::
  Fly   364 CGMGIESLPMTMMED 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 70/331 (21%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 69/330 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.