DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and CG32195

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:405 Identity:96/405 - (23%)
Similarity:188/405 - (46%) Gaps:73/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 SATKPGDNFASKLLKID-IETQLKDHTSKTFSYILKVQPKSTPDNFTDVNMFP-------KEMEM 581
            :.::.|:||.|.:.::. :..:..|...::..||||             ::.|       .|.:|
  Fly    33 AVSQKGENFCSVIYRVALVFRRSPDGALESGKYILK-------------DLLPAAAALGTNEKDM 84

  Fly   582 YQKYVPAFEQLYKDAGLTV---TFTANSFVLNKAVKEEYLLMENLQTKGFKMADRMKGLNMEHTK 643
            ::..:||.:.:.::|...:   ..:|:..::..:..:|..::|:|...|::..||.:|||:|..|
  Fly    85 FEVLLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLGALGYESFDRRQGLNLEEAK 149

  Fly   644 SSLKKLAQWHAAS-IKYKE----LNGAYPPLYNDGIYIEQTRDVFHNMFASAKEAYIRIFGTFEG 703
            ..::||||:|.|| :.|::    :....|..|.:|:         ::.||.|.        ..||
  Fly   150 ICVRKLAQFHGASKVLYEKKPELIQRLSPSHYANGL---------NDRFAQAL--------VLEG 197

  Fly   704 AD-------EYLPKLE-----WIIDNHVDQVLEDAKINEQAFNVLNHGDAWINNIMFQYDAEGRL 756
            |:       |.||::.     .|...:..::.:....|:.:.|.:.|||.|:|||||.:..    
  Fly   198 AEYAAEAFAEELPEISKKMKAQIPKAYTKRMRDVVDPNKSSLNAVIHGDPWLNNIMFDFVN---- 258

  Fly   757 KETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKLLKYNGFVPSLS 821
            |:..|:|.||..:|:||.|||:...:|.:.::.::..|.|:.:|.:||:|..:...|...:|:..
  Fly   259 KKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLNYYFDNLLETLRHCGYKDTLPTFG 323

  Fly   822 ELHAILIEHPAFAVGTVISTLTVCLTDEGFNPEL-------FFVETPESEAFRTKLLGNERYKAH 879
            :|...:.....:...||:..|.:|..    :||.       .||:|......|.:|..:||.:..
  Fly   324 QLKDEMKRCLFYGYYTVVCELPICCA----SPEASVDFGVHTFVDTDAMLKKRHQLFASERVRQT 384

  Fly   880 VEKIMPWLNRRGLLD 894
            ::..:...:|.|:|:
  Fly   385 IKATLLMFDREGILE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 77/311 (25%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 77/311 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.