DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and T16G1.6

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:353 Identity:81/353 - (22%)
Similarity:140/353 - (39%) Gaps:79/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 VSDFAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIE-TQLKDHTSKTFSYILKV---- 560
            |.|..|.|........::...:..:....|:.|.|:::.::.| |..::|..|.|  |||:    
 Worm    22 VKDVQEAIGEQMNTESRLGENTKYTVVGDGNGFMSRVVLVEPEWTITENHLPKKF--ILKICSSL 84

  Fly   561 QPKSTPDNFTDVN--MFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVL----NKAVKEEYLL 619
            ......|...:.|  :...|.|::..:....:.|:..       ..|.:||    ||  .||.|.
 Worm    85 HVHGIVDKMKESNQSINENEEELWAMFENEAQHLHNR-------EVNFYVLAEKWNK--PEELLN 140

  Fly   620 MENLQTKGFKMADRMKG-LNMEHTKS-----------------SLKKLAQWHAASI--------- 657
            .:...:|.|...:::|| |.||:...                 .||.:||..|.|:         
 Worm   141 AKIFFSKKFDSENKLKGFLGMEYVDDVTIRHLYCNLKPYELHPVLKAVAQLQAESLHLSDEELQS 205

  Fly   658 ----KYKELNGAYPPLYND----GIYIEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLPKLEWI 714
                .:|::.|.   ::||    |.| :||||:..... ..|...:..||......|:...|..:
 Worm   206 ISGFDFKQMMGT---MFNDDGLKGNY-KQTRDINPERL-KEKTDIVEAFGMEVVNFEFAGNLNKV 265

  Fly   715 IDNHVDQVLEDAKINEQAFNVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPAQDLY-Y 778
            :..|.|              ||.|||.|..||::. :.:|:...:.::|:|....||||:||. .
 Worm   266 VGIHKD--------------VLVHGDLWAANILWN-ENDGKFSASKVIDYQIIHMGNPAEDLVRV 315

  Fly   779 FLISSAELDIKVDEFDNLIRFYHENLVE 806
            ||.:.:..| :...::.|:..::|..:|
 Worm   316 FLCTLSGAD-RQAHWEKLLEQFYEYFLE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 77/325 (24%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 81/353 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.