DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and T16G1.3

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:382 Identity:89/382 - (23%)
Similarity:161/382 - (42%) Gaps:83/382 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FMLKVP---HNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGL----------------- 166
            |:||:.   |.:..::||       |.::|..|.:....|  |:|:||                 
 Worm    44 FVLKITSCMHVLNVLDQM-------NLQDKSESALWSIFE--YEAQGLHNREVNLYEIIGKWNMD 99

  Fly   167 DITFAPKAF---KLDSVKEPK--LANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAA 226
            |:..:||.|   |.||....|  .|...:.:.:::..:.||...|..::      ||.||.|.|.
 Worm   100 DVLMSPKVFFSKKFDSENLTKGFFAMEYVDNAITRHLYINLKSYELHSI------LKSLAVFQAE 158

  Fly   227 SSMNVQVNGPYEDQFVNG-----VMGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLE 286
            |   :::| ..|.:.|.|     ::|     .|....|:.:.|......      |.||..|..:
 Worm   159 S---LKLN-KREQESVTGYDLEKIVG-----KMFSQNGLNSIFEQVRQI------NKEELSEAAD 208

  Fly   287 KAFVQIF----LDFEHLMTADPDEF-----NVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPK 342
            |  :.:|    ::|:  :..:.:.:     |||.|||.|..|:::| ::|.|.:....:|:|:..
 Worm   209 K--IAVFGVELVNFD--LVKNLNNYLGIKKNVLVHGDLWSANIMWK-ENKDEFRVDKIIDYQSIH 268

  Fly   343 YGSPTQDLFYLILTSVHIDYKLDYFEYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSW 407
            .|:|.:||..|.::::....:..|:|..:..::|...:.|:..........|:|.:.|.:..||.
 Worm   269 LGNPAEDLVRLFISTLSGSERQKYWEKLLEQFYEYFIEALEDKNVPYTLEQLKESYRLYFVTGSL 333

  Fly   408 AVFPSIGVLPIVLL----DPNESATFENFLGDSESSAKFKNLLYTNKRYHGYIEKLL 460
            .:.|..|.:..|.|    ||:|...:...|     :.|.|.||...:..|.|..:::
 Worm   334 LMLPMFGPIAEVKLAEMSDPDEVKKYREIL-----TEKTKRLLNDMEHRHLYTREII 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 70/303 (23%)
EcKinase 529..813 CDD:281023
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 88/376 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.