DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and F48G7.12

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_503277.2 Gene:F48G7.12 / 186000 WormBaseID:WBGene00018623 Length:435 Species:Caenorhabditis elegans


Alignment Length:437 Identity:97/437 - (22%)
Similarity:181/437 - (41%) Gaps:83/437 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLAAHV--DQFSKIVGFQVKPAMAPGEN-----------YATLMLRIS-----IDVELTDKSTKL 119
            |...||  :...|::|.|:......|||           :::.::.:.     .|..|.:|....
 Worm    17 LFQTHVQLEDVQKVIGEQMNTKARLGENTKYTVIGDGNGFSSRVILVEPEWTVSDKHLPEKFVLK 81

  Fly   120 VCFMLKVPHNVPQM----------EQMLAMANFFNSENKVYS-DI-LPKLEELYKAKGLDITFAP 172
            :...|.||..:.||          ::....|.|.|...|::: :: |.|:.|.:...  :...:|
 Worm    82 ITSCLHVPGLIEQMKGKNPGTFPAQEAALWAIFENEAQKLHNREVNLYKITEKWNKN--ETMLSP 144

  Fly   173 KAF---KLDSVKEPKLANTVLMSDLSQDGFKNLNRLECLNLEQTKF--ALKKLAQFHAASSMNVQ 232
            |.:   |.|:..:.|   .:|  .:..||...:..:.| |::..:.  .|:.:|...|.|....:
 Worm   145 KIYFYKKFDAENKTK---GIL--GMEFDGNVTVRHIYC-NVKPRELYPVLRSIATLQAGSLHLTK 203

  Fly   233 -----VNGPYEDQFVNGVMGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREK--LEKAFV 290
                 ::|....|.:..:|  |.|.:..|||      :|..:       |.:...||  :.:||.
 Worm   204 DEIESISGLDVKQMMGSLM--NNEGMKGFYE------QTREI-------NRKRLTEKTNVVEAFG 253

  Fly   291 QIFLDFEHLMTADPDEF-----NVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDL 350
            |..::||  :..:.:::     :|:.|||.|..|:|:|...:|.......:|:|....|:|.:||
 Worm   254 QEVVNFE--LACNLNKYIGIKRDVMVHGDLWAANILWKEKDEGTFSVSKVIDYQLIHMGNPAEDL 316

  Fly   351 FYLILTSVHIDYKLDYFEYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGV 415
            ..|.|:::....:..::|..:..::   |..|..||......||.:|     |......|.|.|:
 Worm   317 VRLFLSTLSGADRQAHWERLLEKFY---TYFLAALGDDEAPYSLEQL-----KECYRCFFVSGGL 373

  Fly   416 LPIVLLDPNESATFENFLGDSESSAKFKNLLYTNKRYHGYIEKLLPW 462
            :.:.:..|...|.. ::|.|.||..:::.:| |.|..| .:|.|..|
 Worm   374 VMMPMYGPFAQAKL-SYLKDIESVQEYQEIL-TEKAEH-LMEDLERW 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 70/336 (21%)
EcKinase 529..813 CDD:281023
F48G7.12NP_503277.2 DUF1679 10..421 CDD:369592 97/437 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.