DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and F20D6.5

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_505104.3 Gene:F20D6.5 / 184724 WormBaseID:WBGene00017635 Length:376 Species:Caenorhabditis elegans


Alignment Length:410 Identity:88/410 - (21%)
Similarity:157/410 - (38%) Gaps:105/410 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 VISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKTFSYILKVQPKSTPDNFTD 571
            ::|..:..|::..||: .....||...|...|.|..:|..|.|.::..:|...       ..|:|
 Worm    32 MLSCVQLVFEEQYGGN-VILKIPGAEAARSRLFIGDDTFCKLHNTEVDAYTFL-------QKFSD 88

  Fly   572 VNM-FPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVKEEYLLMENLQTKGFKMADRMK 635
            .|: :||..|:.:..:..                      ..:|:.:::||.:  .|........
 Worm    89 KNISYPKIYELEKMDISV----------------------DPIKQGHIIMEYM--SGITHLYCYN 129

  Fly   636 GLNMEHTKSSLKKLAQWHAASIKYKELNGAYPPLYNDGIYIEQTRDVFHNMFASA-----KEAYI 695
            .|..:.....:|.||::|:...:..|..|:..|           ||...:.|.:.     |..:|
 Worm   130 NLKPDELIEPVKNLARFHSIGAELDEEEGSNVP-----------RDFLSSWFTTLFTQQNKNTFI 183

  Fly   696 RIFGTFEG-ADEYLP-KLEWIIDNHVDQVLED---AKINEQ-----AFNVLNHGDAWINNIMFQY 750
               |.::| ..::|| |:.......:|.:|..   .|:|..     ...||.|||...:|::::.
 Worm   184 ---GNWKGDLSDWLPSKVARDTIKELDGLLTPEIFLKLNNDCQLTGVQEVLCHGDYSFHNLLYEK 245

  Fly   751 DAEGRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTK------ 809
            ..:|..|...::|.|:..:||.||||....:::.....:.|..|.|::.|::.|::.:|      
 Worm   246 HCDGSYKFRAIVDFQSVNWGNAAQDLSRLFVTAMSGKDRRDSEDRLLKIYYDELIKVSKGNVAPF 310

  Fly   810 ---LLK--YNGFVPSLSELHAILIEHPAFAVGTVISTLTVCLTDEGFNPELFFV------ETPES 863
               .||  |..|.    :|||           .::.|:|         |.||.|      |..|.
 Worm   311 TWEQLKQSYTRFF----QLHA-----------AIVCTVT---------PGLFLVTLSGKHEGKEK 351

  Fly   864 EAFRTKLLGNERYKAHVEKI 883
            ..||..::  |:|...:|.|
 Worm   352 VEFRNIMI--EKYVGLLEDI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 65/310 (21%)
F20D6.5NP_505104.3 PKc_like 11..369 CDD:389743 87/408 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I7597
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.