DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and E02C12.9

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:405 Identity:87/405 - (21%)
Similarity:147/405 - (36%) Gaps:116/405 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 GYIEKLLPWLDNKGFLEAYFINQVVAPETPSSEQPENPKNQILDWLNVSD---FAEVISSAEPEF 515
            |.:|..:.|.|.:..::..|       ||.:....:  ||.    .|:|:   :..:|:      
 Worm     9 GILETYVTWNDVEKMMQKKF-------ETKAKFGED--KNA----TNISEMKGYMSIIA------ 54

  Fly   516 DKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKTFSYILKVQPKSTPDNFTDVNMFPKEME 580
              ::...|....| |.|..||.....::..:.::..|.|..:..|      .|..||.|:..   
 Worm    55 --LINADWVDVEK-GKNVPSKFAVYGLKKFIDENDMKGFLIVDFV------SNAHDVGMYLS--- 107

  Fly   581 MYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVKEEYLLMENLQTKGFKMADRMKGLNMEHTKSS 645
                 :||.|.:....|:: ||:|    |.:.:.:.    |.....|....:||  .:.....||
 Worm   108 -----IPADELIPLVRGIS-TFSA----LGEKLSDN----EKKFAGGSDFLERM--FSQLFNSSS 156

  Fly   646 LKKLAQWHAASIKYKELNGAYPPLYNDGIYIEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLPK 710
            |:|..|                     |:|     .||.      ||.|.::.|..|....|...
 Worm   157 LQKHFQ---------------------GMY-----SVFE------KEKYYQVDGLIETFVVYQKL 189

  Fly   711 LEWIIDNHVDQVLEDAKINE-QAF-NVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPA 773
            |:           :..||:| ..| :||||||.|.:|::...:..|:||...::|.|:.....|.
 Worm   190 LK-----------KYTKISELLGFKSVLNHGDLWQSNMIHSMENNGKLKLEAIIDWQSTVILPPG 243

  Fly   774 QDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKLLKYNGFVPSLSELH----------AILI 828
            .|....::.....:.:.::..:|:..||:..:.     .:...|.|..||.          ||||
 Worm   244 LDTAELIVGCLSAEDRREKGHDLLLLYHKTFIN-----VFGSEVFSFEELQDSYNLYFPMAAILI 303

  Fly   829 EHPAFAVGTVISTLT 843
                  |..:||.:|
 Worm   304 ------VPGMISFMT 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 61/285 (21%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 87/405 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.