DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6834 and C29F7.1

DIOPT Version :9

Sequence 1:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:351 Identity:72/351 - (20%)
Similarity:130/351 - (37%) Gaps:83/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ISIDVELTDKSTKLVCFMLKVPHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITF 170
            :.:||...:.:..:..||    ||..        .|::|...| |:|:..|:..:|.|.......
 Worm    86 VGVDVNKGNAAAIMELFM----HNTE--------CNYYNVFRK-YTDLPMKVPVIYCAAKAGDAE 137

  Fly   171 APKAFKLDSVKEPKLANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNG 235
            ||....:..:.|....:.::      |||         :.:|....:.::...|..|....:...
 Worm   138 APVPVIVMEMFEDCTVHDLI------DGF---------DKDQLFKIVDEIVNLHIFSLTTEEWRS 187

  Fly   236 PYEDQFVNGVMGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFE-HL 299
            ...|..:...:.        .:|.||.:    :..|:......|...:.:||.|     |.: ..
 Worm   188 VLPDSAMRDTVD--------LFEAMVKT----IAENMAKSPGLEIISKYIEKTF-----DKDPSF 235

  Fly   300 MTADPDEF------NVLNHGDCWMNNLLFKLDSKGEVQDML--FVDFQNPKYGSPTQDLFYLILT 356
            ||...||:      :||.|||.|...:|:..|      |.:  .:|:|....|||.:||..::.|
 Worm   236 MTKFSDEYLEGKRKSVLTHGDLWSPQILWDKD------DNIAGIIDWQVGHQGSPMEDLHRILST 294

  Fly   357 SVHIDYKLDYFEYFIRHYHEQLTQHLDLLGFTGKQPSLRE-------------LHMLMYKHGSWA 408
            ...::.:....:..:.||.|:|:..|:..|.  |.|..||             ..:.::.:|.|:
 Worm   295 GTSVENRNKLTKPLLDHYFEKLSAGLEEKGV--KMPWTREEVDEEYNHCFSYGASITIFSNGIWS 357

  Fly   409 VFPSIGVLPIVLLD--PNESATFENF 432
                  ..||:..|  |:.:...|:|
 Worm   358 ------SSPILQTDGKPDPARISESF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 59/289 (20%)
EcKinase 529..813 CDD:281023
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 43/217 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.