DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and pkdc

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:258 Identity:54/258 - (20%)
Similarity:91/258 - (35%) Gaps:86/258 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 LPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKEL 649
            :|:..:.|||.     .::.::||:|..:||.:....:. |.|...| |..:|.:||..|     
Zfish    95 VPLCLAAKSFG-----EEQLIVLEDLDVAGFPVRKTYVN-DAEIKAC-LSWIANFHALFL----- 147

  Fly   650 NGPYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILE--- 711
                      .:..|...||                    |...:|...||.|:...|:.|:   
Zfish   148 ----------DVTPEGLWPI--------------------GTYWHLETRPEELEAMSDQKLKAAA 182

  Fly   712 ---DAKINEQAFNVLNHGDAWINN------------IMFQYESDG-RVKETL-----LLDHQVTK 755
               |:.:|...|..:.||||.:.|            :.|||...| .:|:.:     .:|.:..:
Zfish   183 GEIDSILNNCRFKTIVHGDAKLANFCFSKDGLQVASVDFQYVGGGCGMKDVIYFLGSCMDERECE 247

  Fly   756 YGNPAQDLYYFIMSSTQLDIKVDQFD------------------YLIRWY--HQNMKEHAKLL 798
            ...|....|||......|:.|||..:                  :|:.|.  |..:.:::|.|
Zfish   248 KKAPGLLDYYFSELRKSLEKKVDFAELEKEWRNMFAFAWTDFHRFLLGWMPGHHKINKYSKRL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 54/258 (21%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 46/212 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.