DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG18765

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:429 Identity:109/429 - (25%)
Similarity:199/429 - (46%) Gaps:72/429 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VPKWLNQTQFEELLAADVDQFSKIVGFRVK-------PAMAPGENYATLMLRISIDVELTDKSTK 103
            :|.|:.:.:.|.|: ..:.:|.||...|.|       ||:.           :.|.|.:.|...:
  Fly    16 LPTWVEKKELEALV-KQISEFRKIESLRWKWETQLAEPALC-----------VHIQVLVADNKKR 68

  Fly   104 LVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEP 168
            .||:::|.|...| :...:.....|::|...:..:||.:||||:.....:.|.|...      :.
  Fly    69 QVSYLIKSPETVP-VGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVI------QA 126

  Fly   169 KVANTVLMHDLGQN-GFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMG 232
            |:.::.:..|...| |:...|.|:.|::...:..|::||.:||..|.           ::....|
  Fly   127 KLKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAA-----------YIAKTPG 180

  Fly   233 NNKEAIIAFMEGMLASFRTSFMANLDKFK--------NGEEYREKLEKALAGLTMEFMKLG--IV 287
            ..:| :....|...:...|:.:.:|.:.:        :..:|.:|::.     ..:::|.|  |:
  Fly   181 KIRE-LPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKS-----FQKYVKSGTEIL 239

  Fly   288 D-PNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSH 351
            | ...||.:.:|.||.||||.::::.|:::|.:|..|...:||....||...::::..  .|.|.
  Fly   240 DSKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPA--EKSSR 302

  Fly   352 FDFFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDN 416
            ||.:::.|.:.|:::|.:|.|.|:||||.:|...|:|||.|.......:||:||.|      |.|
  Fly   303 FDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSD------FGN 361

  Fly   417 FMSDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455
              :|..:       |:.|....|.|..:|||::|||:.|
  Fly   362 --NDIEE-------LFRNPVFGEQIRELLPWMENRGYFE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 67/303 (22%)
EcKinase 516..800 CDD:281023
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 67/292 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442565
Domainoid 1 1.000 53 1.000 Domainoid score I7597
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.