DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and AgaP_AGAP007947

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_001237942.2 Gene:AgaP_AGAP007947 / 4578412 VectorBaseID:AGAP007947 Length:284 Species:Anopheles gambiae


Alignment Length:299 Identity:73/299 - (24%)
Similarity:108/299 - (36%) Gaps:100/299 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 LLLENLQPSGFKMV--DRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTA 667
            |:||||:..||:.:  |.....|.||.||.|..||::|:|::..::..|...|....|:. |:.|
Mosquito     5 LVLENLKTQGFETIPSDATRTFDEEHIKCALAALARFHSATILLEKETGTSVPLQFPGLL-EENA 68

  Fly   668 PIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINEQAF-NVLNHGDAWIN 731
            .|.:.   |..:  |||                 |:..||.:|        || :..||      
Mosquito    69 WIRRD---NNPR--IEE-----------------LNIAVDILL--------AFVSCYNH------ 97

  Fly   732 NIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAK 796
                    :.||...||..::..|.......|      |:....|:.:.:.||    |..|...:
Mosquito    98 --------ELRVHRKLLKPNEEKKNAKRENSL------SSVSKRKLTKLEPLI----QQQKFQCE 144

  Fly   797 LLNYNGFI--PSLKE----LHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEEN---- 851
            |.. |.|.  .|||:    |||.:.||          ...:| |:|         .|.|::    
Mosquito   145 LCG-NRFTRKSSLKDHKLILHAGVKQH----------CCKIC-NRT---------FGREDSLNTH 188

  Fly   852 -----GKSLREAMFSNERYRANI------ERVMPWINRR 879
                 ||..|..:.|....:.|.      |..||...|:
Mosquito   189 MALHVGKKFRCKLCSKSFAKGNFLRKHLEEHEMPDSKRK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 49/197 (25%)
AgaP_AGAP007947XP_001237942.2 PKc_like <3..>67 CDD:304357 22/62 (35%)
COG5048 <96..267 CDD:227381 39/177 (22%)
C2H2 Zn finger 143..164 CDD:275368 6/21 (29%)
zf-C2H2_6 170..192 CDD:290623 6/41 (15%)
C2H2 Zn finger 172..192 CDD:275368 5/29 (17%)
C2H2 Zn finger 199..219 CDD:275368 2/19 (11%)
C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 258..278 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.