DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CHKov2

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:431 Identity:143/431 - (33%)
Similarity:222/431 - (51%) Gaps:52/431 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PKWLNQTQFEELLAADVDQFSKIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMMKV 111
            |:|:.:..|..||......|..|:.|....|::.||||.|::|||.|:::|.|.|.:.||:::|:
  Fly     7 PQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKI 71

  Fly   112 PHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDI--KFAPRAFKLDATKEPKVANTV 174
            |. .|: ::.......|.:|...|..::|::|:|| ||...|  ||.|...|...  ||..::.:
  Fly    72 PL-VPE-DEKNDFHEMFDAELDMYDHLIPELEDLY-AKNTSISPKFKPVHLKFPG--EPVKSDYI 131

  Fly   175 LMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPY-PDIFVNGVMGNNKEAI 238
            |:.||.:.|::|.:|.:.|...:.:..|.:|||:|||.|..|...|.| .||         :|:.
  Fly   132 LLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDI---------RESY 187

  Fly   239 IAFMEGMLASFRTSFMANLDKFKNG---------EEYREKLE-----------KALAGLTMEFMK 283
                      |.|.....||:|...         ::|  .||           ..|..|.:||  
  Fly   188 ----------FTTEHQKLLDEFNINFCMPFLECMQQY--NLEPGQLVLISDYTSQLTDLNIEF-- 238

  Fly   284 LGIVDPNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYK 348
             |..||.|.:.|||||.|.||.:||..::.::||:.|||||.||||:||.|||..:::|.:...|
  Fly   239 -GKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIK 302

  Fly   349 LSHFDFFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSAT 413
            |..||:||.:|.:.||:||.:|.:....|:|.:.|..|.:|..|.......:||:|||.|...:.
  Fly   303 LDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSH 367

  Fly   414 FDNFMSDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFL 454
            ..|.|.:|.:.::|:..::......:.|:.|||||.|||::
  Fly   368 IGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGYI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 109/314 (35%)
EcKinase 516..800 CDD:281023
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 109/314 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.